SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005778814.1.92643 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005778814.1.92643
Domain Number 1 Region: 48-179
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-34
Family Calponin-homology domain, CH-domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005778814.1.92643
Sequence length 391
Comment hypothetical protein EMIHUDRAFT_353871 [Emiliania huxleyi CCMP1516]; AA=GCF_000372725.1; RF=representative genome; TAX=280463; STAX=2903; NAME=Emiliania huxleyi CCMP1516; strain=CCMP1516; AL=Scaffold; RT=Major
Sequence
MTDHHFMSTRVPTKPVSNAVHAGYDGAAKRDDGIPLYGMDKELADKAAAKFDPKMEREAR
EWIEAVTGEALEGTLQEALKSGVVLCALVNALKPGVCKKPSTMKMAFQQMENIAKYLEAC
SALGVPKHDLFQTVSLYENQDMMAVVTNIHSLGRVSGKVPGYGGPTLGAKLADRSVRHFD
EETLRKGRAEQTFLGKGSHGHASQAGTVDTSRNIGKMDKVRGIDGLGTDASVTAVGMGSH
GHASQAGTVDTSRNIGKVDHVKGIGGLGTDASVTAVGMGSHGHASQAGTFDTSKNISKVD
HVKGIDGLGGDGTTTAVGMGSHGHASQAGTFDTSKNIDRTTNIKGIDGLGTDGISQINLG
SHGHATQEGMGKMHGTREIVHQTFGGAAAAA
Download sequence
Identical sequences R1EI78
jgi|Emihu1|353871|fgenesh_newKGs_kg.24__37__EST_ALL.fasta.Contig12366 XP_005778814.1.92643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]