SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005786220.1.92643 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005786220.1.92643
Domain Number 1 Region: 39-156
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.61e-22
Family Calponin-homology domain, CH-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005786220.1.92643
Sequence length 163
Comment hypothetical protein EMIHUDRAFT_429434 [Emiliania huxleyi CCMP1516]; AA=GCF_000372725.1; RF=representative genome; TAX=280463; STAX=2903; NAME=Emiliania huxleyi CCMP1516; strain=CCMP1516; AL=Scaffold; RT=Major
Sequence
MTDYTPKAAQDKQVNHGVYVQPTEDGNFGLDKDIADNAKKKYDFAKEQEVRTWIEKVLGV
KLEDGLGALELQKVLQSGVVLCQLANKIKTGVCKLPRSTTQPAVQRENISFYLEACKKLG
MTDNFIFMTDNLFQDRLVELAMMSVINNLCELKNIAEKSSPAA
Download sequence
Identical sequences R1FE66
jgi|Emihu1|429434|estExtDG_Genewise1Plus.C_1540031 XP_005786220.1.92643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]