SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005786416.1.92643 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005786416.1.92643
Domain Number 1 Region: 6-112
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-27
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005786416.1.92643
Sequence length 207
Comment hypothetical protein EMIHUDRAFT_252978 [Emiliania huxleyi CCMP1516]; AA=GCF_000372725.1; RF=representative genome; TAX=280463; STAX=2903; NAME=Emiliania huxleyi CCMP1516; strain=CCMP1516; AL=Scaffold; RT=Major
Sequence
MPLNSGALLGWCQRETATYDGVSVENWSRSWNDGLAFCALLHRHFPDDIRFGSLNSSTPQ
SRARNFELAFGVAERRLDVERLFDVEDMMATYPRPDGRSVTTYVVLLYNAIEERGMVAAT
PAVQLTPLPLPDRSEDDSALSPAELAMIRKCNQKMEALNAKLQHSPRSHVPTAEEQAMLL
SMAALNAALESDARNPARPRYGFMTTR
Download sequence
Identical sequences R1CA93
jgi|Emihu1|209209|gm1.3700261 jgi|Emihu1|252978|gm1.151700002 XP_005772017.1.92643 XP_005786416.1.92643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]