SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005787878.1.92643 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005787878.1.92643
Domain Number 1 Region: 26-251
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.18e-58
Family Calponin-homology domain, CH-domain 0.00019
Further Details:      
 
Domain Number 2 Region: 542-662
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000403
Family Spectrin repeat 0.0026
Further Details:      
 
Weak hits

Sequence:  XP_005787878.1.92643
Domain Number - Region: 420-531
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000348
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number - Region: 800-904
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00158
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005787878.1.92643
Sequence length 1477
Comment hypothetical protein EMIHUDRAFT_462452 [Emiliania huxleyi CCMP1516]; AA=GCF_000372725.1; RF=representative genome; TAX=280463; STAX=2903; NAME=Emiliania huxleyi CCMP1516; strain=CCMP1516; AL=Scaffold; RT=Major
Sequence
MGVFGKKSTPAGTTAEDADFASKAASMREAQDAQQLKTFTRWWNSVLKPRGVKIEDLVVE
VSPGVNPIMLYEELSGTLVKKYSKKPPSRFQKLENQNIFLKALKEKGIRLVNIGAEDLVD
SNRTLICGLTWTLILRYEIQKYGANESELLRWVKACTAGYKGVNITTWGDSFNDGLAFCA
LLHKHDENVLNYDKNSDPKKALGNLDTAFTAAEKRWDVPRLLEPEELAGPDPTDEKSVIT
YVAKLRQAFLDREAEMMRKLKEEEEARKKAEREARQAALKKMVQDLKTGVDDWNKWTKGK
EGDFRKKEGEAPSYPEERCEKELEGLKKFRTEKGKDDKPPKAEEKARLADLYNKVRGEIM
ADAMDAAKEGYQPVFDEGEIADCAPEVLGGKWKDMEKAERDFEDALGRRLADLDAAKRAK
ETDDLLKGLKDKADELMDWLKGKKGDMDGDARSIGDEDDIAKKQAKLDKLLSDEKPPKLD
ETGELAKELHAVADRLAAEGRDPPPDLEGKLQGGWNAFDDAAAALQKALDDARKKAARDK
AMAETDKLQKENEDDANKWLDKVNDKAKDFEDKVKSGDLGNTKEEAEKKLADLRSPFQSD
TKPEWGKERGGIDAGRRAVDDRRKDEDRPPADWKPPGDDLDKGWKRLGDAEREYEKALLD
KLGKLDAEEQERLKKAARKEKALADIADELPPLVQRRKVEKDAAAAAAEAAQKAADIADW
AQKETAALQEQLAALEGDKVSPAEPPLAALEKFCNGDKTAKQGDLLDARAAACDAIATRQ
LQRAGAGGPADAAIAESLPKAEEAWAAMEEAERRLKHALQDKIKRAQGANLEWERLKRGC
TRVAEWLAASTPERMRSELGGTEAEVTALLEEARAVSAALGLQIASVAILTPLAERLFKD
EEYAERAKAAIGTVDMLPSLAAPMAERVARLEEELERQRRLTAERRAFSEATGALEASIV
EAEELVGFPVDTVDTAEIIKALREVGDKQESDLLPAPEAAEPDAIKRAEAACATWRQLSS
MMPPRAAACEAAHRAALAAEKLQCDYREAAEAFRKWHAGAVALLTMPAGDDARAADDVRK
AAEIAIEQLPVGEAHHRAAKVASDKMASYSIAQNPSVLTLAQMSAALTQMRSLLSLLQGA
AKLAPGNATLPTKKIVAALEDLAEATGVSPASLGSEFGLPDEHVKFLEDEMEKKNGALQP
TSFDPFPADRSAVPTLSLPTIPLDLRAHGLAVIEHVNKARKEPENHADTLEAALSDAYEG
NHLTCPPSWGGKKLVTAEGVGALRDLLKALRKATGNLPTLRLVAALDDAAQQAAEELAAG
KSPTDLTTRLSSRGTFSGSAGEAIVYGVRQPEPIAAQLLLSDGDAQRRNRSFLMNGDLKV
AGFGLADHPQHGSVCVIVCTSLFATPIDKPMTVECQGEANDDFQRVLDAIPSEQARDIAT
DALVVGKKVKLDYVPGSIDITVYERDGSARTSSLKWA
Download sequence
Identical sequences R1FPX2
jgi|Emihu1|462452|estExtDG_fgeneshEH_pg.C_140128 XP_005787878.1.92643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]