SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_005893366.1.15283 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005893366.1.15283
Domain Number 1 Region: 3-153
Classification Level Classification E-value
Superfamily L domain-like 9.01e-30
Family U2A'-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005893366.1.15283
Sequence length 249
Comment PREDICTED: acidic leucine-rich nuclear phosphoprotein 32 family member A [Bos mutus]; AA=GCF_000298355.1; RF=representative genome; TAX=72004; STAX=72004; NAME=Bos mutus; AL=Scaffold; RT=Major
Sequence
MDMDKRIHLELRNRTPSDVKELVLDNCRSNEGKIEGLTDEFEELEFLSTINVGLTSVANL
PKLNKLKKLELSDNRISGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDL
FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDDEEDEDEEEYD
EDAQVVEDEEDEEEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKRE
PEDEGEDDD
Download sequence
Identical sequences P51122
ENSBTAP00000016410 ENSBTAP00000016410 NP_001181948.1.59421 NP_001181948.1.76553 XP_004010315.1.66739 XP_005893366.1.15283 XP_006054837.1.26621 XP_010832807.1.44457 XP_011985812.1.54773 XP_020736161.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]