SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005984301.1.78601 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005984301.1.78601
Domain Number 1 Region: 616-871
Classification Level Classification E-value
Superfamily YWTD domain 8.63e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 5-264
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-56
Family YWTD domain 0.00000129
Further Details:      
 
Domain Number 3 Region: 315-561
Classification Level Classification E-value
Superfamily YWTD domain 1.14e-49
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 4 Region: 919-1178
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-39
Family YWTD domain 0.0000435
Further Details:      
 
Domain Number 5 Region: 873-920
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000628
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1309-1347
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000746
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 571-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000838
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 1231-1269
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1271-1307
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 267-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000441
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 11 Region: 1188-1241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000542
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005984301.1.78601
Sequence length 1597
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Pantholops hodgsonii]; AA=GCF_000400835.1; RF=representative genome; TAX=59538; STAX=59538; NAME=Pantholops hodgsonii; AL=Scaffold; RT=Major
Sequence
MSAAPLLLYANRRDLRLVDAANGKENATIVVGGLEDAAALDFVFSHGLIYWSDVSEEAIK
RIEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQE
LDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSDRFVIINTEIYWPNGLTLDYEERKL
YWADAKLNFIHRSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWTDWNTHSILACNKYTGE
GLREIHSNIFSPMDIHVFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVTL
LENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYW
TDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTM
RKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLA
LDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIE
RVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEDNGGCSHLCLYRPQGLRCACPI
GFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRI
YWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDG
QHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGL
TIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIE
RANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGC
PAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLD
KQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPNQNLEIQPYDLSIDIYSRYIYWTCEATN
VINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVL
FFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDTNILQPVGLTVFENW
LYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSH
ICLVKGDGTTRCSCPMHLVLLQDELLCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTEC
EDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCANG
QCIGKHKKCDHNLDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTIYFICQR
MLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSS
GPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYS
YRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVVTAKGYTSDLNYDSEPVPPPPTPRSQ
YLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_005984301.1.78601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]