SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005988071.1.90931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005988071.1.90931
Domain Number 1 Region: 632-887
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-55
Family YWTD domain 0.00000351
Further Details:      
 
Domain Number 2 Region: 22-279
Classification Level Classification E-value
Superfamily YWTD domain 5.36e-55
Family YWTD domain 0.00000242
Further Details:      
 
Domain Number 3 Region: 331-576
Classification Level Classification E-value
Superfamily YWTD domain 1.22e-51
Family YWTD domain 0.00000192
Further Details:      
 
Domain Number 4 Region: 934-1193
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-40
Family YWTD domain 0.0000493
Further Details:      
 
Domain Number 5 Region: 1324-1359
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000785
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 1245-1285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 7 Region: 1286-1321
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 588-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000562
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 9 Region: 890-936
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000641
Family EGF-type module 0.02
Further Details:      
 
Domain Number 10 Region: 285-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000689
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1204-1255
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000153
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005988071.1.90931
Sequence length 1525
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 isoform X3 [Latimeria chalumnae]; AA=GCF_000225785.1; RF=representative genome; TAX=7897; STAX=7897; NAME=Latimeria chalumnae; AL=Scaffold; RT=Major
Sequence
MEVSLFGLLLSCNFLFVAASPVLLFANRRDVRVVDGGSVKPESSIVVSGLEDAAAVDFLY
SEGVIYWTDVSEEAIKQTYFNQSGNVQKVVISGLVSPDGLACDWLGKKLYWTDSETNRIE
VANLNGTLRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGRTRKIIVDSD
IYWPNGLTIDLEEQKLYWADAKLSFIHRSNLDGSFRQKVVEGTLTHPFALTLSGDTLYWT
DWQTRSIHACNKKTGGRKREILGGIYSPMDIQVLSRERQQYSQTPCEDNNGGCSHLCLLS
PKDPFYSCACPTGVQLREDRRTCKSGADKVLLLARRTDLRRISLDMPDFTDIVLQIDGIR
HAIAIDYDPVEGYIYWTDDEVRAIRRAYLDGSGAETLVTTEIQHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTARKILISENLDEPRAIVLNPLTGYLYWTDWGENPKIERANLDGSD
RIILVNTSLGWPNGLALDLTEGKLYWGDAKTDKIEVINTDGTERKTLLEDKLPHIFGFTL
LGDYIYWTDWQRRSIERVHKTRATREIIIDQLPDLMGLKAAHVTQTFGTNPCAENNGGCS
HLCFYTPLGPRCFCPMGLELLSDMKTCIIPEAFLMFTSRAAIHRISLETNNNDVAIPLTG
VKEASALDFDVSDNRIYWTDISLKTISRAFMNGSSIDHVIEFGLDCPEGMAVDWMGKNLY
WADTGTNRIEVARLDGKYRQVLVWKDLDNPRTLALDPAKGYMYWTEWGGKPRIVRAHMDG
ANSLTLVDKIGRANGLTIDYAERRLYWIDFDTCMIESSDMMGNDREIIADDLPHPFGLTQ
YRDYIYWTDWNLHSIQRADKTNGQNRTMIQGHLEFVMDILIFHSSRQDGSNDCMQNSGYC
AHLCLAVPEGYKCGCASHYTLDANNKNCSSPTSFLLFSQKTAISRMVLDEQQSPDIILPI
HGLRNIKAIDYDPLDKLIYWVDGRQNTVKRAKDDGTQPFIVACAPNQSSNPEKQPHDLSI
DIYSRTVYWTCETTNTINVHRLDGKSIGVVLRGDHDKPRAIVVNAERGYLYFTNFQERSP
KIERAALDGTEREVLFTTGLIGPVALVIDNKLGKLFWVDADLKRIESSDLSGANRVTLED
SNILQPVGLTVLGDHLYWVDRQQQMIERVEKLNGFKRTRIQGRIPHLTDIHAVEEVNMKE
FASHPCSHDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFTCATGEI
DCIPMAWRCDGFPECEDHSDEQNCPVCSANQFECEKGQCIDARLRCNGEIDCQDKSDEAD
CDAICRPNQFRCGSGLCILMKQQCDSFPDCSDGSDELSCGISCGKSMISSMSLMGGSSGA
PLYDRNHVTGASSSSSSSTKGTFYPQILNPPPSPATDRSLYNTEMFYSSNSPSTTRSYRP
YLMRGTVPHTTPYSTDVCDSDYTTSRWKTNKYYIDLNSDSDPYPPPPTPRSQYMSAEESC
PPSPATERSYFHLCPPPPSPCTDSS
Download sequence
Identical sequences XP_005988071.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]