SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005988072.1.90931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005988072.1.90931
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-55
Family YWTD domain 0.00000351
Further Details:      
 
Domain Number 2 Region: 180-425
Classification Level Classification E-value
Superfamily YWTD domain 1.12e-51
Family YWTD domain 0.00000192
Further Details:      
 
Domain Number 3 Region: 783-1042
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-40
Family YWTD domain 0.0000493
Further Details:      
 
Domain Number 4 Region: 1-128
Classification Level Classification E-value
Superfamily YWTD domain 7.46e-28
Family YWTD domain 0.0000998
Further Details:      
 
Domain Number 5 Region: 1173-1210
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000576
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 1094-1134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 7 Region: 1135-1170
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 437-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000368
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 9 Region: 739-785
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000591
Family EGF-type module 0.02
Further Details:      
 
Domain Number 10 Region: 134-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1053-1104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000143
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_005988072.1.90931
Sequence length 1448
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 isoform X4 [Latimeria chalumnae]; AA=GCF_000225785.1; RF=representative genome; TAX=7897; STAX=7897; NAME=Latimeria chalumnae; AL=Scaffold; RT=Major
Sequence
MYWTDWGETPRIERAGMDGRTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRSNL
DGSFRQKVVEGTLTHPFALTLSGDTLYWTDWQTRSIHACNKKTGGRKREILGGIYSPMDI
QVLSRERQQYSQTPCEDNNGGCSHLCLLSPKDPFYSCACPTGVQLREDRRTCKSGADKVL
LLARRTDLRRISLDMPDFTDIVLQIDGIRHAIAIDYDPVEGYIYWTDDEVRAIRRAYLDG
SGAETLVTTEIQHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTARKILISENLDEPRAI
VLNPLTGYLYWTDWGENPKIERANLDGSDRIILVNTSLGWPNGLALDLTEGKLYWGDAKT
DKIEVINTDGTERKTLLEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKTRATREIIIDQ
LPDLMGLKAAHVTQTFGTNPCAENNGGCSHLCFYTPLGPRCFCPMGLELLSDMKTCIIPE
AFLMFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSDNRIYWTDISLKTISRAFM
NGSSIDHVIEFGLDCPEGMAVDWMGKNLYWADTGTNRIEVARLDGKYRQVLVWKDLDNPR
TLALDPAKGYMYWTEWGGKPRIVRAHMDGANSLTLVDKIGRANGLTIDYAERRLYWIDFD
TCMIESSDMMGNDREIIADDLPHPFGLTQYRDYIYWTDWNLHSIQRADKTNGQNRTMIQG
HLEFVMDILIFHSSRQDGSNDCMQNSGYCAHLCLAVPEGYKCGCASHYTLDANNKNCSSP
TSFLLFSQKTAISRMVLDEQQSPDIILPIHGLRNIKAIDYDPLDKLIYWVDGRQNTVKRA
KDDGTQPFIVACAPNQSSNPEKQPHDLSIDIYSRTVYWTCETTNTINVHRLDGKSIGVVL
RGDHDKPRAIVVNAERGYLYFTNFQERSPKIERAALDGTEREVLFTTGLIGPVALVIDNK
LGKLFWVDADLKRIESSDLSGANRVTLEDSNILQPVGLTVLGDHLYWVDRQQQMIERVEK
LNGFKRTRIQGRIPHLTDIHAVEEVNMKEFASHPCSHDNGGCSHICIAKGDGTPRCSCPV
HLVLLQNLLTCGEPPTCSPDQFTCATGEIDCIPMAWRCDGFPECEDHSDEQNCPVCSANQ
FECEKGQCIDARLRCNGEIDCQDKSDEADCDAICRPNQFRCGSGLCILMKQQCDSFPDCS
DGSDELSCAETNKPPLDEPQSHSSAIGPVIGIILSLFVMGGMYFFCQRVVCQRPFPHEYI
SGTPHVPLNFIAPGSSPHGTFTGISCGKSMISSMSLMGGSSGAPLYDRNHVTGASSSSSS
STKGTFYPQILNPPPSPATDRSLYNTEMFYSSNSPSTTRSYRPYLMRGTVPHTTPYSTDV
CDSDYTTSRWKTNKYYIDLNSDSDPYPPPPTPRSQYMSAEESCPPSPATERSYFHLCPPP
PSPCTDSS
Download sequence
Identical sequences XP_005988072.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]