SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005988722.1.90931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005988722.1.90931
Domain Number 1 Region: 633-888
Classification Level Classification E-value
Superfamily YWTD domain 5.1e-55
Family YWTD domain 0.00000341
Further Details:      
 
Domain Number 2 Region: 22-282
Classification Level Classification E-value
Superfamily YWTD domain 1.06e-52
Family YWTD domain 0.00000238
Further Details:      
 
Domain Number 3 Region: 332-570
Classification Level Classification E-value
Superfamily YWTD domain 7.98e-52
Family YWTD domain 0.00000286
Further Details:      
 
Domain Number 4 Region: 936-1197
Classification Level Classification E-value
Superfamily YWTD domain 6.54e-38
Family YWTD domain 0.0000507
Further Details:      
 
Domain Number 5 Region: 890-938
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000325
Family EGF-type module 0.011
Further Details:      
 
Domain Number 6 Region: 589-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000445
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 7 Region: 1328-1366
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000072
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 8 Region: 1249-1289
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 9 Region: 1290-1325
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000654
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 10 Region: 284-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000403
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 11 Region: 1207-1259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000156
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_005988722.1.90931
Sequence length 1618
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 isoform X1 [Latimeria chalumnae]; AA=GCF_000225785.1; RF=representative genome; TAX=7897; STAX=7897; NAME=Latimeria chalumnae; AL=Scaffold; RT=Major
Sequence
MGAAVLRNLLLCSFSSLLRASPLLLYANRRDLRLVDAASGKVNATIVVSGLEDAAAVDFV
YHKGFIYWSDVSEEAIKRIVFNKTGNLQSVVVSGLVSPDGLACDWLGEKLYWTDSETNRI
EVSNLDGSLRKVVFWEELDQPRAISLDPVRGYMYWTDWGEVPKIERAGMDGTDRSIIIDT
NIYWPNGLTLDYTERKLFWADAKLSFIHKSNLDGTYRQVVVEGSLPHPFALTLFRETLYW
TDWNTHSIHSCNKYSGLDRREVHSQIFSPMDIHVFNQQRQPNSTNPCGTNNGGCSHLCLM
SPSKPGYRCACPTGVRLLEDRKTCRDGASELLLLARRTDLRRISLDTPDFTDIVLQLDDI
RHAIAIDYDPVEGYVYWTDDEVRAIRRSFLDGSGSQFVVTSQVAHPDGIAVDWIGRNLYW
TDTGTDRIEVTRLNGTMRKILISEELDEPRAIVLDPVAGYMYWTDWGERSKIERADLDGS
DRIVLVNTSLGWPNGLALDYAEGKIYWGDAKTDKIEFMNTDGSGRRVLVEDKLPHIFGFT
LLGDYIYWTDWQRRSIERVHKHTAEREVIIDQLPDLMGLKATNVHQIKGTNPCAENNGGC
SHLCLYRPQGVRCACPIGFELINDMKTCIFPEAFLLFSRRADIRRISLETNNSNVAIPLT
GVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNL
YWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMD
GTGRITLVPSVGRANGLTIDYSERRLYWTDLDTSLIESSNMLGLDREVIADDLPHPFGLT
QYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQGGWNECASSNGH
CSHLCLAVPIGGYVCGCPAHFNLNSDNKTCSAPTSFLLFSQKNAISRMVIDEQQSPDIIL
PIHSLRNVKAIDYDPLEKQLYWIDSRQNVIRKAQEDGSQVQSFTVVANTVPNQNLDMQPY
DLSIDIFGRCIYWTCEATNVINVTRLDGMPVGVVLKGEQDKPRAIVVNPQRGYLYFTNLQ
DRSPKIERAALDGTEREVLFLSGLGRPIALAIDDQLGKLFWADSDLRRIESSDLSGANRI
VLADSNILQPIGLTVFGDHLYWIDKQQQMIERIEKTGREGRTKIQARITQLSDIHAVKQL
NVGEYGAHPCSQDNGGCTHICIVKGDGTTRCSCPVHLVLLSDELSCGEPPTCSPDRFTCS
TGEIDCIPLAWRCDGYSECKDDSDEQNCPVCSETQFHCASGQCIDGSLKCNGEVNCQDKS
DEKNCDDLCPSNQYRCANGKCIGKHKRCDHNSDCTDNSDESGCYPTEEPTPQPTNTIGSI
IGIILSVFVVGAMYFVFQRVLCPRMRCDDETMTNDFVVHGSASVPPGYVPHPSSLSGSLA
GNGVSRGKSLMSSLSIMGGSSGPPYDRSHVTGASSSSSSSTKGTYFPPILNPPPSPATER
SHYIMEFGYSSTSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYTPSRRVTMARAVKG
YASDLNYDSEPFPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_005988722.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]