SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006008901.1.90931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006008901.1.90931
Domain Number 1 Region: 84-426
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.83e-87
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000108
Further Details:      
 
Domain Number 2 Region: 464-550
Classification Level Classification E-value
Superfamily DUSP-like 0.00000000000497
Family DUSP, domain in ubiquitin-specific proteases 0.012
Further Details:      
 
Domain Number 3 Region: 955-1010
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000132
Family Ubiquitin-related 0.01
Further Details:      
 
Weak hits

Sequence:  XP_006008901.1.90931
Domain Number - Region: 743-817
Classification Level Classification E-value
Superfamily DUSP-like 0.0196
Family DUSP, domain in ubiquitin-specific proteases 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006008901.1.90931
Sequence length 1043
Comment PREDICTED: ubiquitin carboxyl-terminal hydrolase 48 isoform X1 [Latimeria chalumnae]; AA=GCF_000225785.1; RF=representative genome; TAX=7897; STAX=7897; NAME=Latimeria chalumnae; AL=Scaffold; RT=Major
Sequence
MAPRLQLEKAAWRWTELVSPEEVRQEHIEMAYRIRLEACKRGVCRRNCKGNPNCLVGMGE
HIWLGEIDENSFHNIDDPNSERRKKNTFVGLTNLGATCYVNTFLQVWFHNLELRRALYLC
QSTKAEEEIQEDKDYEPQTICEHLQYLFALLQNSNRRYIDPSEFVKALGLDTGQQQDAQE
FSKLFLSLLEDTLCKEKNPDVQNIIQKQFCGQYAYVTVCSHCGRESKLLSKFYELELNIQ
GHKQLTDCVTEFLKEEKLEGENRYFCEACQSKHNATRKIRLLSLPRTLNLQLMRFVFDRQ
TGHKKKLNTYIGFPEVLDMGAYMDQKDQSCVYELNAVLIHRGVSAYSGHYIAHVRDARTG
EWYKFNDEEIEKMEGKKLQLGIEEDIAEPSKSQTRKPKCGKGTHCSRNAYMLVYRQQEDV
EEQKQADIQIPAFLQRLVELDNHRFEEWCVEMADMRQQSVNKGKAKHEEVKELYQRLPAT
ADQPYEFVPLDWLQKWLDESTPTKPIDNSKFLCPHGKLHPDQISHMKRVSQSAVEVLYGR
YGGGPRLTASALCRDCVVERCRVLRLKNQLNEDYKVISNLLKATLPSNEGYWVGKASLRS
WRQLVLEQLDEPEDEMEQSNGKANGEKHSDLQNKEDGMNVDKKYEEEQLNFNEDILCPHG
GLCVSESERKLVSDKVWEMLMVYFPKAPQFRHTEESCKNCKVLEREGEENEALNKMMANE
QKTALPNLFHDKNRPTLAPWPQETDILFVVSQFFVEEWKKFIRRPARGNPVSSVGNTALL
CPHGGLMFTVDSMTKEDSKLIALIWPKEWEIIHKLFLVDQAIKIERRAECPEGGAVMAAY
RTEPEICLECREGLLCQQRRDLREYTQATVYIRKVVDNKKVIKEAIPDLNVSNSEAEEEK
EEGNMEGERDPDFNQANGAAKKQKVSHLGGSNIIYQKSGIRRSTRHRKVRGEKALIVSAN
QTLKELKIQIMHAFSVAPFDQNLAIEGRMLTDDNATLGSLGVVPESVIFLKADEPIADYG
AIDDVMQVCMPEEGFKGTGLLGH
Download sequence
Identical sequences H2ZVL3
XP_006008901.1.90931 ENSLACP00000001434 ENSLACP00000001434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]