SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006031859.1.24877 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006031859.1.24877
Domain Number 1 Region: 624-879
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-56
Family YWTD domain 0.00000331
Further Details:      
 
Domain Number 2 Region: 13-272
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-55
Family YWTD domain 0.00000148
Further Details:      
 
Domain Number 3 Region: 323-558
Classification Level Classification E-value
Superfamily YWTD domain 7.32e-49
Family YWTD domain 0.00000356
Further Details:      
 
Domain Number 4 Region: 927-1185
Classification Level Classification E-value
Superfamily YWTD domain 5.23e-40
Family YWTD domain 0.0000386
Further Details:      
 
Domain Number 5 Region: 881-929
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000317
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1239-1277
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 579-626
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000384
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 8 Region: 1279-1315
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000471
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 9 Region: 1317-1355
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 10 Region: 275-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000313
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 11 Region: 1196-1249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006031859.1.24877
Sequence length 1604
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Alligator sinensis]; AA=GCF_000455745.1; RF=representative genome; TAX=38654; STAX=38654; NAME=Alligator sinensis; AL=Scaffold; RT=Major
Sequence
MCLFSCPPIKAAPLLLYANRRDLRLVDAANGKENATVVVGGLEDAAAVDFVFVQGLIYWS
DVSEEAIKRTEFNKTGSVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSL
RKVLFWQELDQPRAIALDPARGFMYWTDWGEVPKIERAGMDGSSRSVIINTDIYWPNGLT
LDYEERKLYWADAKLNFIHKSNLDGSHRQAVVKGSLPHPFALTLFGDMLYWTDWNTHSIL
ACNKYSGEDLHEVHSNIFSPMDIHAFNQQRQPNATNPCGTNNGGCSHLCLMSPTKSSYHC
ACPTGVQLLENGKTCKEGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYD
PVEGYIYWTDDEVRAIRRSFVDGSGCQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIE
VTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRIVLVNTS
LGWPNGLALDYAESKIYWGDAKTDKIEVMNSDGTGRRVLVEDKLPHIFGFTLLGDYVYWT
DWQRRSIERVHKRTAEREIIIDQLPDLMGLKATNVHQIIGTNPCADDNGGCSHLCLYRPQ
GLRCACPIGLELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALD
FDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNR
IEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVP
NVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLDREVIADDLPHPFGLTQYQDYIYWT
DWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVP
IGGFVCGCPAHYSLNFDNRTCSAPTTFLLFSQKNAINRMVIDEQQSPDIILPIHSLRNVR
AIDYDPLDKQLYWIDSRQNIIRKAQEDGSQSLTVVASPVPNQNLDMQPYDLSIDIYSRYI
YWTCEATNVINVTRLDGRSMGVVLKGDQDRPRAIVVNPEKGYMYFTNLQERSPKIERAAL
DGTEREVLFFSGLSKPVALAIDSQLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPV
GLTVFENWLYWIDRQQQMIEKMDMTGQGGRTKVQARIAQLSDIHAVKELNIQEYRQHPCS
QDNGGCSHICIVKGDGTTRCSCPVHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAW
RCDGFTECEDHSDEKNCPVCSDSQFQCESGQCVESSLRCNGEANCQDNSDEKNCEVLCLT
DQFRCTSGQCIGKNKKCDHNLDCSDNSDKHGCYTTEEPAPQPNNTIGSIIGVILTVFVVG
AMYFICQRVLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSVISS
LSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATERSHYTLEFGYSSNS
PSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRVTTAVAKGYTSDLNYDSEPVPP
PPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A1U7S9W6
XP_006031859.1.24877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]