SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006053430.1.26621 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006053430.1.26621
Domain Number 1 Region: 64-215
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.36e-36
Family G proteins 0.000043
Further Details:      
 
Domain Number 2 Region: 223-261
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000209
Family SOCS box-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006053430.1.26621
Sequence length 312
Comment PREDICTED: ras-related protein Rab-40B isoform X2 [Bubalus bubalis]; AA=GCF_000471725.1; RF=representative genome; TAX=89462; STAX=89462; NAME=Bubalus bubalis; breed=Mediterranean; AL=Scaffold; RT=Major
Sequence
MAGRSPSALCQAAGTAGLAVLQGPLDPRGAGLPGHRLCAVPWAGHGRGRWRGTMSTGGSP
VRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPAGIDYKTTTILLDGRRVKLQL
WDTSGQGRFCTIFRSYSRGAQGVILVYDIANRWSFDGIDRWIKEINERQVPTEQARAYAE
RLGVTFFEVSPLCNFNITESFMELARIVLLRHGMDRLWRPSKVLSLQDLCCRAVVSCTPA
HLLDRLPLPTALRSHLKSFSMATGLSARMAQGRPCSLASGSSHKRTSLRKAKGTHLPQSP
PRRCSRNNCKVS
Download sequence
Identical sequences XP_006053430.1.26621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]