SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006076506.1.26621 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006076506.1.26621
Domain Number 1 Region: 446-701
Classification Level Classification E-value
Superfamily YWTD domain 7.19e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 145-391
Classification Level Classification E-value
Superfamily YWTD domain 9.55e-50
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 3 Region: 749-1008
Classification Level Classification E-value
Superfamily YWTD domain 1.14e-39
Family YWTD domain 0.0000435
Further Details:      
 
Domain Number 4 Region: 1-94
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000000000392
Family YWTD domain 0.00031
Further Details:      
 
Domain Number 5 Region: 703-750
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000576
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1139-1177
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 401-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000733
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 1061-1099
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000119
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1101-1137
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 97-139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 11 Region: 1018-1071
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000488
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006076506.1.26621
Sequence length 1427
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Bubalus bubalis]; AA=GCF_000471725.1; RF=representative genome; TAX=89462; STAX=89462; NAME=Bubalus bubalis; breed=Mediterranean; AL=Scaffold; RT=Major
Sequence
MYWTDWGEVPKIERAGMDGSDRFVIINTEIYWPNGLTLDYEERKLYWADAKLNFIHRSNL
DGTNRKYTGEGLREIHSNIFSPMDIHVFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFY
QCACPTGVTLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAID
YDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDR
IEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVN
TSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVY
WTDWQRRSIERVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEDNGGCSHLCLYR
PQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASA
LDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGT
NRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTL
VPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIY
WTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLA
VPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRN
VRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPNQNLEIQPYDLSIDIYSR
YIYWTCEATNVINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERA
ALDGTEREVLFFSGLSKPVALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDTNILQ
PVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHP
CAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELLCGEPPTCSPQQFTCFTGEIDCIPV
AWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLC
LIDQFRCANGQCIGKHKKCDHNLDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFV
SGTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMI
SSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSS
NSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVVTAKGYTSDLNYDSEP
VPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_006076506.1.26621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]