SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006081375.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006081375.1.53796
Domain Number 1 Region: 528-747
Classification Level Classification E-value
Superfamily Bet v1-like 3.5e-40
Family STAR domain 0.0055
Further Details:      
 
Domain Number 2 Region: 127-247
Classification Level Classification E-value
Superfamily PH domain-like 9.06e-26
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006081375.1.53796
Sequence length 756
Comment PREDICTED: collagen type IV alpha-3-binding protein isoform X7 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MQYSGVPIPPPSSAPPPSPPGVTREGRRLASTGPSPGGGAGRSAGVTAAAAADGWKGRLP
SPLVLLPRSARCQAQRRRRRAGRTSSYLQHPPARERALFPSPSSDISPRGLGAASGAAHG
AGAGLLLACRASMSDNQSWNSSGSEEDPETEFGPPVERCGVLSKWTNYIHGWQDRWVVMK
NNTLSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQW
IDAIEQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFR
DILCRQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHNTNGNKEKLF
PQVTPKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREESWQKRMDKEMEKRRRIE
EGYKNAMIELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLH
WPTSMPSGDAFSSVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTYS
LQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVR
NDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSAIRKIPALTENDPETWIV
CNFSVDHDSAPLNNRCVRAKINIAMICQTLVSPPEGNQKISRDNILCKITYVANVNPGGW
APASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Download sequence
Identical sequences G1P202
ENSMLUP00000003875 ENSMLUP00000003875 XP_006081375.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]