SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006102542.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006102542.1.53796
Domain Number 1 Region: 640-895
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-56
Family YWTD domain 0.00000581
Further Details:      
 
Domain Number 2 Region: 28-288
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-55
Family YWTD domain 0.00000166
Further Details:      
 
Domain Number 3 Region: 339-569
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-51
Family YWTD domain 0.00000321
Further Details:      
 
Domain Number 4 Region: 942-1201
Classification Level Classification E-value
Superfamily YWTD domain 7.32e-39
Family YWTD domain 0.0000653
Further Details:      
 
Domain Number 5 Region: 1330-1368
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1252-1290
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 7 Region: 1292-1328
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000107
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 8 Region: 595-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000198
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 9 Region: 898-945
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000199
Family EGF-type module 0.016
Further Details:      
 
Domain Number 10 Region: 293-336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000649
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1209-1261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000368
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006102542.1.53796
Sequence length 1610
Comment PREDICTED: LOW QUALITY PROTEIN: low-density lipoprotein receptor-related protein 5 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MMVNLARLHYYGFCATLKENKSWYKASPLLLFANRRDVRLVDAGGVKLESTVVVSGLEDA
AAVDFQFSKGTVYWTDVSEEAIKQTYLNQTGAAVQNVVISGLVSPDGLACDWVGKKLYWT
DSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGST
RKVIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTL
SGDTLYWTDWQTRSIHACNKRTGEKRKEILRALYSPMDIQVLSPERQPYIHTQCEEDNGG
CSHLCLLSPREPFYTCACPTGVQLQDNGKTCKAGAEEVLLLARRTDLRRISLDTPDFTDI
VLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAVDW
VARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIALHPMMGLMYWTDWGENPKIE
CANLDGQERRVLVNTSLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRMLLEDKL
PHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNPC
ADQNGGCSHLCFFTPRATKCGCPIGLELLSDMKTCIVPEAFLVFTSRATIHRISLETNNN
DVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFLNGSSVEHVIEFGLDYPEGMAV
DWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPR
IVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERIVIADDL
PHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLND
CVPGNGQCGQLCLAVPGGHRCSCASHYTLDPSSRNCSPPSTFLLFSQKNAISRMIPDDQH
SPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRARDDGTQPFILTTPSPNQSPDRQ
PHDLSIDVYSRTLFWTCEATNTINVHRLDGDAMGVVLRGDRDKPRAIVVNAERGYLYFTN
MQDRTAKIERAALDGTEREVLFTTGLIRPVALVVDNTLGKLFWVDADLKRIESCDLSGAN
RLTLEDANIVQPVGLTVLGRHLYWIDRQQQMIERVEKTTGDKRTRVQGRVAHLTGIHAVE
DISLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFT
CATGEIDCIPXAWRCDGFPECDDQSDEEGCPVCSDAQFPCARGQCVDLRLRCDGEADCQD
RSDEADCDALCLPNQFRCASGQCILIKQQCDSFPDCIDGSDELMCEITKPPLDEGPAHSS
AIGPVIGIILSLFVMGGVYFVCQRVVCQRYTGANGPFPHEYVSGTPHVPLNFIAPGASQH
GPFTGISCGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPA
TDPSLYNVDVFYSSNIPAPARPYRPYIIRGIAPPTTPCSTDVCDSDYSASRWKASKYYLD
LNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences XP_006102542.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]