SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006142468.1.99106 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006142468.1.99106
Domain Number 1 Region: 29-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.32e-93
Family Calponin-homology domain, CH-domain 0.00000302
Further Details:      
 
Domain Number 2 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 7.33e-34
Family Spectrin repeat 0.0000843
Further Details:      
 
Domain Number 3 Region: 2173-2292
Classification Level Classification E-value
Superfamily PH domain-like 1.51e-33
Family Pleckstrin-homology domain (PH domain) 0.0000192
Further Details:      
 
Domain Number 4 Region: 1640-1793
Classification Level Classification E-value
Superfamily Spectrin repeat 8.04e-30
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 5 Region: 601-741
Classification Level Classification E-value
Superfamily Spectrin repeat 1.85e-29
Family Spectrin repeat 0.00026
Further Details:      
 
Domain Number 6 Region: 1010-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-28
Family Spectrin repeat 0.0000031
Further Details:      
 
Domain Number 7 Region: 1851-2005
Classification Level Classification E-value
Superfamily Spectrin repeat 4.91e-27
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 8 Region: 1229-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 3.96e-24
Family Spectrin repeat 0.00075
Further Details:      
 
Domain Number 9 Region: 815-950
Classification Level Classification E-value
Superfamily Spectrin repeat 1.01e-23
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 10 Region: 1532-1661
Classification Level Classification E-value
Superfamily Spectrin repeat 4.58e-23
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 11 Region: 425-526
Classification Level Classification E-value
Superfamily Spectrin repeat 5.23e-22
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 12 Region: 745-849
Classification Level Classification E-value
Superfamily Spectrin repeat 1.09e-19
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 13 Region: 529-636
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-18
Family Spectrin repeat 0.00068
Further Details:      
 
Domain Number 14 Region: 2011-2070
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000173
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 15 Region: 1386-1481
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000034
Family Spectrin repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006142468.1.99106
Sequence length 2329
Comment PREDICTED: spectrin beta chain, erythrocytic [Tupaia chinensis]; AA=GCF_000334495.1; RF=representative genome; TAX=246437; STAX=246437; NAME=Tupaia chinensis; AL=Scaffold; RT=Major
Sequence
MTSATEFENVGNQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSHLARVSCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALL
LWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFDV
AERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIET
EKMIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKFQEKG
NLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALRNELIRQEKL
EQLARRFDRKAAMRETWLNENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRA
LEDLAQELEKENYHDQKRIMARKDNILRLWNYLQELLRSRRQRLETTLALQKLFQDMLHS
IDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITAATLRFTEGKGY
QPCDPQVIQDRVSHLEQCFGELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIY
SSLDYGKDLTSVLILQRKHKAFEDELRGLDTHLEQIFQEAEGMVARKQFGHPQIEARIKE
VSAQWDQLKELAAFRKKNLQDAENFFQFQGDADDLKSWLQNAYQLLSGEDMGQDEGATRA
LGKKHKDFMEELEESRGVMEHLEQQAQGFPQEFRDSPDVTNRLQALRELYQKVVAQADLR
QQRLQDALDLYTVFGETDACELWMGEKEKWLTQMKTPDTLEDLEVVQHRFDILDQEMKTL
MAQIDGVNLAANNLVESGHPRSGEVKKYQDHLNTRWQAFQAMVLEKREAVDSALRVHNYC
VDCEETSKWILDKTKVVESTKDLGRDLAGVIAIQRKLSGLERDVAAIQARVGSLERESQR
LMESHPELKEVIGQRQAYVEELWQGLQQALKGQEASLGEASQLQAFLQDLDDFQAWLSMA
QKAVASEDTPESLPEAEQLLQQHADIKDEIDKHQESFRHVKESGEKVIQDQTDPEYLLLG
QRLEGLDTGWDALCRMWESRGHSLAQCRGFQEFQKDAKQAEAILSNQEYTLTHLEPPNSL
EAAEAGIRKFEDFLVSMENNQDKVLSPVDFGNKLVAEGNLYSDKIKEKVQLIEDRHRKNN
KTAQDISVLLRDNLELQNFLQNCEELTLWINEKLLTSQDVSYDEARNLHNKWLKHQAFMA
ELASHQGWLENIDAEGKLLMEEKPQFTDRVSPKLEALHRLWDELQATTKEKAQQLSAARS
SDLRSQTHADLNKWISAMQEQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKAELEELFD
QVPLLGEEAGDADLSIEKRFLDLLEPLGRRKKQLESSKAKLQIGRDLEDETLWVEERLPL
AQSADYGSNLQTVQLFMKKNQTLQNEILGHAPRIEDVLRRGQQLVEAAEIDCGDIQERLG
HLQGSWDTLREAAAGRLQRLRDANEAQQYYLDAGEAEAWISEQELYVISDETPKDEEGAI
VMLKRHLRQQRAVEEYGRNIKQLAGRAQGLLSAGHPEGEQIIRLQGQVDKQYAGLKDMAE
ERKRKLENMYHLFQLKREADDLEQWIAEKELVASSPEMGQDFDHVTLLRDKFRDFARETG
AIGQERVDNVNAIIEQLIDAGHGEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLH
RYFYTGTEILGLIDEKHRELPEDVGPDASTAESFHRVHTAFERELHLLGVQVQQFQDVAT
RLQTAYAGEKADAIQNKEQEVSAAWQALLKACAGRRTQLVDTADKFRFFSMARDLLSWME
SIIRQIETQERPRDVSSVELLMKYHQGIKAEMETRSKNFSACLELGESLLQRQHQASDEI
SEKLRQVVSRRKEMNEKWEARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASRDFGHT
VDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQTPERPTEEPGPQEEEGETAG
EAPRVHRAATERTSPGEEKGPWPQDQQPPPPPGQREDEQEKSGGDKRPATEPVFKVLDTP
LSEGDEPTTLPTQRDHGHSVQMEGYLGRKHDLEGPNKKASNRSWNNLYCVLRNSELTFYK
DAKNLALGVPYHGEEPLALRHAICEIAANYKKKKHVFKLRLSNGSEWLFHGKDEEEMVSW
LQGVSTAINESQSIRVKAQSLPLPPLSGPDVSLGKKDKEKRFSFFPKKK
Download sequence
Identical sequences XP_006142468.1.99106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]