SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006159093.1.99106 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006159093.1.99106
Domain Number 1 Region: 25-263
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.67e-91
Family Calponin-homology domain, CH-domain 0.000000909
Further Details:      
 
Domain Number 2 Region: 282-403
Classification Level Classification E-value
Superfamily Spectrin repeat 6.94e-36
Family Spectrin repeat 0.0000528
Further Details:      
 
Domain Number 3 Region: 590-729
Classification Level Classification E-value
Superfamily Spectrin repeat 3.48e-32
Family Spectrin repeat 0.0002
Further Details:      
 
Domain Number 4 Region: 998-1153
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-29
Family Spectrin repeat 0.0000216
Further Details:      
 
Domain Number 5 Region: 1210-1363
Classification Level Classification E-value
Superfamily Spectrin repeat 9.36e-28
Family Spectrin repeat 0.00047
Further Details:      
 
Domain Number 6 Region: 1526-1683
Classification Level Classification E-value
Superfamily Spectrin repeat 9.4e-28
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 7 Region: 1846-2000
Classification Level Classification E-value
Superfamily Spectrin repeat 2.19e-27
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 8 Region: 799-938
Classification Level Classification E-value
Superfamily Spectrin repeat 2.12e-26
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 9 Region: 412-515
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-23
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 10 Region: 1686-1791
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-23
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 11 Region: 516-624
Classification Level Classification E-value
Superfamily Spectrin repeat 5.1e-22
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 12 Region: 733-833
Classification Level Classification E-value
Superfamily Spectrin repeat 3.74e-20
Family Spectrin repeat 0.00064
Further Details:      
 
Domain Number 13 Region: 1371-1469
Classification Level Classification E-value
Superfamily Spectrin repeat 6.54e-16
Family Spectrin repeat 0.0006
Further Details:      
 
Domain Number 14 Region: 1981-2066
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000017
Family Spectrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006159093.1.99106
Sequence length 2155
Comment PREDICTED: spectrin beta chain, non-erythrocytic 1 [Tupaia chinensis]; AA=GCF_000334495.1; RF=representative genome; TAX=246437; STAX=246437; NAME=Tupaia chinensis; AL=Scaffold; RT=Major
Sequence
MELQRTSSISGPLTPTYTGQVPYNYNQLEGRFKQLQDEREAVQKKTFTKWVNSHLARVSC
RITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENM
GSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNV
NIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDP
EDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASD
LLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKM
RANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAM
RETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENY
HDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLS
QDYGKHLLGVEDLLQKHALVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRV
AHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSV
MRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLGQLS
AIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEI
ANYRPTIDSLHEQAGALPQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYK
MFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIAR
QLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIRE
KTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAI
LSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNT
LTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNE
LHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQED
FMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKD
NRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKI
EKEGMQLISEKPETEVVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLD
KWLHGLESQIQSDDYGKDLTSVNILISHPQMLENQMEVRKKEIEELQSQAQALSQEGKST
DEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDH
GHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLNAEAIRQRLADLKQL
WGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKK
HQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGK
LDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQE
RVDTVNHMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHD
AKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAA
YAGDKADDIQKRENEVLEAWKALLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQ
IEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLL
QLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVE
KLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRPPSPEPSTKLSEEA
ESQQQWDTSKGEQVSQNGLPAEQGSPRVSYRSQTYQNYKNFNSRRTASDQPWSGL
Download sequence
Identical sequences XP_006159093.1.99106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]