SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006164876.1.99106 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006164876.1.99106
Domain Number 1 Region: 622-877
Classification Level Classification E-value
Superfamily YWTD domain 8.63e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 11-270
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-54
Family YWTD domain 0.00000144
Further Details:      
 
Domain Number 3 Region: 321-560
Classification Level Classification E-value
Superfamily YWTD domain 7.72e-50
Family YWTD domain 0.00000341
Further Details:      
 
Domain Number 4 Region: 925-1184
Classification Level Classification E-value
Superfamily YWTD domain 3.92e-39
Family YWTD domain 0.0000435
Further Details:      
 
Domain Number 5 Region: 879-926
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000067
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1315-1353
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 1236-1276
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000128
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 577-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000131
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 9 Region: 1277-1313
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000759
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 273-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000718
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1194-1247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000766
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006164876.1.99106
Sequence length 1603
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Tupaia chinensis]; AA=GCF_000334495.1; RF=representative genome; TAX=246437; STAX=246437; NAME=Tupaia chinensis; AL=Scaffold; RT=Major
Sequence
MVKHIVEEAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFGHGLIYWSDV
SEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRK
VLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINTEIYWPNGLTLD
YEERKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWTDWNTHSILAC
NKYSGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCAC
PTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPV
EGYIYWTDDEVRAIRRSFIDGSGSQFVVTSQIAHPDGIAVDWVARNLYWTDTGTDRIEVT
RLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRIVLVNTSLG
WPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDW
QRRSIERVHKRSAEREVIIDQLPDLMGLKATSVHRITGSNPCAEENGGCSHLCLYRPQGL
RCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFD
VTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIE
VSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNV
GRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDW
SRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVG
GFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAI
DYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPNQNLEIQPYDLSIDIYSRYIYW
TCEATNVINVTRLDGRSIGLVLKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDG
TEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGL
TVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQD
NGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRC
DGFTECEDHSDELNCPVCSESQFPCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQ
FRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTI
YFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLS
IMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPS
THRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDLNYDSEPVPPP
PTPRSQYLSAEENCESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_006164876.1.99106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]