SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006169690.2.99106 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006169690.2.99106
Domain Number 1 Region: 97-151
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000262
Family VPS37 C-terminal domain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006169690.2.99106
Sequence length 355
Comment PREDICTED: vacuolar protein sorting-associated protein 37C isoform X1 [Tupaia chinensis]; AA=GCF_000334495.1; RF=representative genome; TAX=246437; STAX=246437; NAME=Tupaia chinensis; AL=Scaffold; RT=Major
Sequence
MESLKDKTLQELEEMQNDPEAINRLALESPEVQDLQLEREMALATNRSLAERNLEFQGPL
EISRSNLSDKYQELRKLVERCQEQKAKLEKFSSALQPGTLLDLLQIEGMKIEEESEAMAE
KFLEGEVPLETFLENFSSMRMLSHLRRVRVEKLQDVVRKPRASQELAGDAPPPRPPPPPR
PVSQATPSVAEEQPPPPSGVPPYPLPYSPSPSMPVGPTAHGALQPAPFPVVSQPSFYSGP
VGPGHSSAQPGSQAAAGYSWSPQRSTPPRPGYPVAPTGASGPGYPVAGGRAPSPGYPQQS
PYLPTGGKPPYPTQPQLPGFPGQPQPSFPPQPPYPPGPAPPYGFPPPQGPVWPGY
Download sequence
Identical sequences L8Y5I8
XP_006169690.2.99106 XP_014440110.1.99106 XP_014440111.1.99106 XP_014440112.1.99106 XP_014440116.1.99106 XP_014440117.1.99106 XP_014440118.1.99106 XP_014440119.1.99106 XP_014440120.1.99106 XP_014440121.1.99106 XP_014440122.1.99106 XP_014440123.1.99106 XP_014440124.1.99106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]