SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006199929.1.17985 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006199929.1.17985
Domain Number 1 Region: 632-887
Classification Level Classification E-value
Superfamily YWTD domain 8.76e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 21-280
Classification Level Classification E-value
Superfamily YWTD domain 9.94e-56
Family YWTD domain 0.0000015
Further Details:      
 
Domain Number 3 Region: 331-570
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-49
Family YWTD domain 0.00000341
Further Details:      
 
Domain Number 4 Region: 935-1194
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-39
Family YWTD domain 0.0000427
Further Details:      
 
Domain Number 5 Region: 889-936
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000167
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1325-1363
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000759
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 587-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000838
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 8 Region: 1247-1285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1287-1323
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000458
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 283-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000598
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1204-1257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000542
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006199929.1.17985
Sequence length 1613
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 isoform X1 [Vicugna pacos]; AA=GCF_000164845.2; RF=representative genome; TAX=30538; STAX=30538; NAME=Vicugna pacos; AL=Scaffold; RT=Minor
Sequence
MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDASNGKENATIVVGGLEDAAAVDFVF
SHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPSSGLMYWTDWGEVPKIERAGMDGSSRLIIINTE
IYWPNGLTLDYEERKLYWADAKLNFIHRSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWT
DWNTHSILACNKYTGEGLREIHSNIFSPMDIHVFSQQRQPNATNPCGIDNGGCSHLCLMS
PVKPFYQCACPTGVRLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSD
RVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTL
LGDYVYWTDWQRRSIERVHKRSAEREIIIDQLPDLMGLKATNVHRIIGSNPCAEENGGCS
HLCLYRPQGLRCACPIGFELVSDMRTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQ
YQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILP
IHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPNQNLEIQPYDLS
IDIYSRYIYWTCEATNVINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERS
PKIERAALDGTEREVLFFSGLSKPVALALDSRLGKLFWADSDLRRIESSDLSGANRIVLE
DSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQ
EYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELLCGEPPTCSPQQFTCFTGE
IDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCTSGQCIDGALRCNGDANCQDKSDEK
NCEVLCLIDQFRCANGQCIGKHKKCDHNLDCSDKSDELDCYPTEEPAPQATNTVGSVIGV
IVTIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMS
RGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTM
EFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDL
NYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_006199929.1.17985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]