SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006210778.1.17985 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006210778.1.17985
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 6.67e-56
Family YWTD domain 0.00000555
Further Details:      
 
Domain Number 2 Region: 180-410
Classification Level Classification E-value
Superfamily YWTD domain 1.26e-50
Family YWTD domain 0.00000266
Further Details:      
 
Domain Number 3 Region: 783-1042
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-36
Family YWTD domain 0.0000722
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 6.8e-28
Family YWTD domain 0.0000845
Further Details:      
 
Domain Number 5 Region: 1171-1209
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1133-1169
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1093-1131
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 436-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000287
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 9 Region: 739-790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000259
Family EGF-type module 0.03
Further Details:      
 
Domain Number 10 Region: 135-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000205
Family EGF-type module 0.013
Further Details:      
 
Domain Number 11 Region: 1050-1102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000791
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006210778.1.17985
Sequence length 1451
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 isoform X1 [Vicugna pacos]; AA=GCF_000164845.2; RF=representative genome; TAX=30538; STAX=30538; NAME=Vicugna pacos; AL=Scaffold; RT=Minor
Sequence
MYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANL
DGSLRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEKRKEILSALYSPMDI
QVLSPERQPYFHTRCEEDNGGCSHLCLLSPREPFYACACPTGVQLQDNGQTCKAGAEEVL
LLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDG
SGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAI
VLHPVMGLMYWTDWGENPKIECANLDGQERHVLVNTSLGWPNGLALDLQEGKLYWGDAKT
DKIEVINMDGTKRQTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQ
LPDLMGLKAVNVAKAVGTNPCADRNGGCSHLCFFTPRATKCGCPIGLELLSDMKTCIVPE
AFLVFTSRAAIHRISLDTSNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFM
NGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPR
SLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCITLVDKVGRANDLTIDYADQRLYWTDLD
TNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQG
HLDFVMDILVFHSSRQDGLNDCMHNNGQCGQLCLAVPSGHRCSCASHYTLDPSSRNCSPP
TTFLLFSQKCAISRMIPDDQHSPDLVLPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAK
DDGTQPFVLTSPSQSQNPDRQPHDLSIDVYSRTLFWTCEATNTINVHRLNGDAMGVVLRG
DRDKPRAIVVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNMLG
KLFWVDADLKRIESCDLSGANRLTLEDANIVQPVGLTVLGRHLYWIDRQQQMIERVEKTM
GAERTRVQGRVAHLTGIHAVEDVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHL
VLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFP
CARGQCVDLRLRCDGEADCQDRSDEADCDAVCLPNQFRCASGQCILITQQCDSFPDCIDG
SDELLCEITKLPSDDSPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGANGPFPH
EYVSGTPHVPLNFIAPGGSQHGPFPGISCSKSMMSSVSLMGGRAGVPLYDRNHVTGASSS
SSSSTKATLYPPILNPPPSPATDPSLYNVDVFYSSNIPATARPYRPYIIRGMAPPTTPCS
TDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLF
PPPPSPCTDSS
Download sequence
Identical sequences XP_006210778.1.17985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]