SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006231272.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006231272.1.100692
Domain Number 1 Region: 533-941,985-1008
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.19e-97
Family Glycine dehydrogenase subunits (GDC-P) 0.000000192
Further Details:      
 
Domain Number 2 Region: 70-489
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.91e-97
Family Glycine dehydrogenase subunits (GDC-P) 0.00000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006231272.1.100692
Sequence length 1024
Comment PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial isoform X1 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MQLCARAWGLRLGPGAGGGHRLARGTGLSWAPRSRDSSSGGGGGGGDRGAAGASRLLERL
LPRHDDFARRHIGPGDKDRREMLQALGLASIDELIEKTVPASIRLKRPLKLEDPVCENEI
LETLHAIASKNQIWRSYIGMGYYNCSVPQTILRNLLENSGWVTQYTPYQPEVSQGRLESL
LNYQTMVSDITGLDMANASLLDEATAAAEAMQLCHRHNKRKRFFIDPRCHPQTIAVVQTR
AKYRGVIVELKLPHEMDFSGKDVSGVLFQYPDTEGKVEDFTELVERAHQTGSLTCCATDL
LALCILRPPGEFGVDIALGNSQRFGVPLGYGGPHAAFFAVRESLVRMMPGRMVGVTRDAT
GKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMFAIYHGSHGLQHIAKRVHNATL
ILSEGLKRAGHQLQHDLFFDTLKVQCGCSLKEVLGRAAQRQINFRLFDDGTLGISLDETV
TEKDLDDLLWIFGCESSTELVAEGMGEEWRGLLGSSFKRTSPFLTHQVFNSYHSETNLVR
YMKKLENKDISLVHSMIPLGSCTMKLNSSSELTPITWREFANIHPFVPLDQAQGYQQLFQ
ELEKDLCELTGYDRVSFQPNSGAQGEYAGLATIRAYLDQKGERHRTVCLIPKSAHGTNPA
SAYMAGMKIQPVEVDRYGNIDVAHLKAMVDKHKENLAAIMITYPSTNGVFEENISDVCAL
IHQHGGQVYLDGANMNAQVGICRPGDFGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHL
VPFLPSHPIVCLKPNEDTWPVGTVSAAPWGSSSILPISWAYIKMMGGKGLKEATEIAILN
ANYMAKRLERYYRVLFRGARGYVAHEFILDTRPFKKSANIEAVDVAKRLQDYGFHAPTMS
WPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVT
SSRWDRPYSREVAAFPLPFVKPENKFWPTIARIDDIYGDQHLVCTCPPMEVYESPFSEQK
RASS
Download sequence
Identical sequences ENSRNOP00000043788 10116.ENSRNOP00000015456 XP_006231272.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]