SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006234294.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006234294.1.100692
Domain Number 1 Region: 129-373
Classification Level Classification E-value
Superfamily vWA-like 4.08e-87
Family Integrin A (or I) domain 0.0000000435
Further Details:      
 
Domain Number 2 Region: 371-458
Classification Level Classification E-value
Superfamily Integrin domains 3.19e-23
Family Integrin domains 0.00026
Further Details:      
 
Domain Number 3 Region: 622-704
Classification Level Classification E-value
Superfamily Integrin beta tail domain 3.27e-18
Family Integrin beta tail domain 0.0011
Further Details:      
 
Domain Number 4 Region: 21-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000434
Family Plexin repeat 0.0011
Further Details:      
 
Domain Number 5 Region: 581-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000781
Family Integrin beta EGF-like domains 0.0025
Further Details:      
 
Domain Number 6 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Domain Number 7 Region: 80-155
Classification Level Classification E-value
Superfamily Integrin domains 0.0000068
Family Integrin domains 0.002
Further Details:      
 
Weak hits

Sequence:  XP_006234294.1.100692
Domain Number - Region: 501-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0237
Family Integrin beta EGF-like domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006234294.1.100692
Sequence length 787
Comment PREDICTED: integrin beta-6 isoform X1 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MGIELVCLFLLLLGRNDHVQGGCAWSGAETCSDCLLTGPHCAWCSQENFTHLSGAGERCD
TPENLLAKGCQLPFIENPVSQVEILQNKPLSVGRQKNSSDIVQIAPQSLVLKLRPGGEQT
LQVQVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLAKEMSKLTSNFRLGFGSFVEK
PVSPFMKTTPEEITNPCSSIPYFCLPTFGFKHILPLTDDAERFNEIVRKQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDNRNE
YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNI
LQLIISAYEELRSEVELEVLGDTEGLNLSFTALCSNGILFPHQKKCSHMKVGDTASFNVS
VSITNCEKRSRKLIIKPVGLGDTLEILVSAECDCDCQREVEANSSKCHHGNGSFQCGVCA
CNPGHMGPRCECGEDMVSTDSCKESPGHPSCSGRGDCYCGQCVCHLSPYGSIYGPYCQCD
NFSCLRHKGLLCGDNGDCDCGECVCRDGWTGEYCNCTTSRDACASEDGVLCSGRGDCVCG
KCVCRNPGASGPTCERCPTCGDPCNSRRSCIECYLSADGQAQEECEDKCKATGATISEEE
FSKDTSVPCSLQGENECLITFLITADNEGKTIIHNISEKDCPKPPNIPMIMLGVSLAILL
IGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKHK
VGLSSDG
Download sequence
Identical sequences Q6AYF4
NP_001004263.1.100692 NP_001004263.1.4139 XP_006234294.1.100692 XP_006234295.1.100692 ENSRNOP00000011030 10116.ENSRNOP00000011030 ENSRNOP00000011030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]