SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006243547.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006243547.1.100692
Domain Number 1 Region: 2-138
Classification Level Classification E-value
Superfamily UBC-like 2.75e-39
Family RWD domain 0.000000342
Further Details:      
 
Weak hits

Sequence:  XP_006243547.1.100692
Domain Number - Region: 150-227
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.0706
Family Duffy binding domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006243547.1.100692
Sequence length 292
Comment PREDICTED: RWD domain-containing protein 2A isoform X1 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MSASIKESLQLQLLEMEMLFSMFPNQGEVKLEDVNALTNIKRYLDGTREALPPNIEFVIT
LQIEEPKVTIDLQVTMPHSYPYVALQLFGRSPELDRQQQLLLNQGLSAYLGTFDPGELCV
CAAIQWLQDNSASYFLNRKLSDEPSVQPKPVKNTFLRMWIYSHHIYQQDLRKKILEVGKR
LDVTGFCMTGKPGIICVEGFKDHCEEFWHTIRYPNWKHISCKHAETVETEGDGEDLRLFH
SFEELLLEAHGDYGLRNDYHMNLGQFLEFLRKHKSEHVFQILFGIESKSSES
Download sequence
Identical sequences D3ZAT3
ENSRNOP00000012864 ENSRNOP00000012864 NP_001102243.1.100692 NP_001102243.1.4139 XP_006243545.1.100692 XP_006243547.1.100692 XP_006243548.1.100692 10116.ENSRNOP00000012864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]