SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006251782.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006251782.1.100692
Domain Number 1 Region: 124-232
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 5.36e-35
Family Elongation factor TFIIS domain 2 0.0046
Further Details:      
 
Domain Number 2 Region: 2-91
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 2.22e-27
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000658
Further Details:      
 
Domain Number 3 Region: 249-299
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 1.96e-17
Family Transcriptional factor domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006251782.1.100692
Sequence length 301
Comment PREDICTED: transcription elongation factor A protein 1 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MEDEVVRIAKKMDKMVQKKNAAGALDLLKELKNIPMTLELLQSTRIGMSVNAIRKQSTDE
EVTSLAKSLIKSWKKLLDGPSTDKDSEEKKKEPAISSQNSPEAREESSSSSHVSSRKDET
NARDTYVSSFPRAPSTSDSVRLKCREMLAAALRTGDDYVAIGADEEELGSQIEEAIYQEI
RNTDMKYKNRVRSRISNLKDAKNPNLRKNVLCGNIPPDLFARMTAEEMASDELKEMRKNL
TKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKF
C
Download sequence
Identical sequences Q4KLL0
10116.ENSRNOP00000010893 NP_001020906.1.100692 NP_001020906.1.4139 XP_003752832.1.4139 XP_006237878.1.100692 XP_006251782.1.100692 ENSRNOP00000010893 ENSRNOP00000010893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]