SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006267963.1.47583 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006267963.1.47583
Domain Number 1 Region: 633-888
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-56
Family YWTD domain 0.00000331
Further Details:      
 
Domain Number 2 Region: 22-281
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-55
Family YWTD domain 0.00000148
Further Details:      
 
Domain Number 3 Region: 332-567
Classification Level Classification E-value
Superfamily YWTD domain 1.24e-48
Family YWTD domain 0.00000361
Further Details:      
 
Domain Number 4 Region: 936-1194
Classification Level Classification E-value
Superfamily YWTD domain 6.93e-40
Family YWTD domain 0.00004
Further Details:      
 
Domain Number 5 Region: 890-938
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000317
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 588-635
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000389
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 7 Region: 1247-1287
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 1288-1324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000654
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1326-1364
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 10 Region: 284-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000265
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 11 Region: 1205-1258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000453
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006267963.1.47583
Sequence length 1613
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 isoform X1 [Alligator mississippiensis]; AA=GCF_000281125.3; RF=representative genome; TAX=8496; STAX=8496; NAME=Alligator mississippiensis; AL=Scaffold; RT=Major
Sequence
MGPAPRRLLLLAALCALARAAPLLLYANRRDLRLVDAANGKENATVVVGGLEDAAAVDFV
FVQGLIYWSDVSEEAIKRTEFNKTGSVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRI
EVSNLDGSLRKVLFWQELDQPRAIALDPARGFMYWTDWGEVPKIERAGMDGSSRSVIINT
DIYWPNGLTLDYEERKLYWADAKLNFIHKSNLDGSHRQAVVKGSLPHPFALTLFGDMLYW
TDWNTHSILACNKYSGEDLHEVHSNIFSPMDIHAFNQQRQPNATNPCGTNNGGCSHLCLM
SPTKSSYQCACPTGVQLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDI
RHAIAIDYDPVEGYIYWTDDEVRAIRRSFVDGSGCQFVVTAQIAHPDGIAVDWVARNLYW
TDTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGS
DRIVLVNTSLGWPNGLALDYAESKIYWGDAKTDKIEVMNSDGTGRRILVEDKLPHIFGFT
LLGDYVYWTDWQRRSIERVHKRTAEREIIIDQLPDLMGLKATNVHQIIGTNPCADDNGGC
SHLCLYRPQGLRCACPIGLELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLT
GVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNL
YWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMD
GSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLDREVIADDLPHPFGLT
QYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGH
CSHLCLAVPIGGFVCGCPAHYSLNFDNRTCSAPTTFLLFSQKNAINRMVIDEQQSPDIIL
PIHSLRNVRAIDYDPLDKQLYWIDSRQNIIRKAQEDGSQSLTVVASPVPNQNLDMQPYDL
SIDIYSRYIYWTCEATNVINVTRLDGRLMGVVLKGDQDRPRAIVVNPEKGYMYFTNLQER
SPKIERAALDGTEREVLFFSGLSKPVALAIDSQLGKLFWADSDLRRIESSDLSGANRIVL
EDSNILQPVGLTVFENWLYWIDRQQQMIEKMDMTGQGGRTKVQARIAQLSDIHAVKELNI
QEYRQHPCSQDNGGCSHICIVKGDGTTRCSCPVHLVLLQDELSCGEPPTCSPQQFTCFTG
EIDCIPVAWRCDGFTECEDHSDEKNCPVCSDSQFQCESGQCVENSLRCNGEANCQDNSDE
KNCEVLCLTDQFRCTSGQCIGKNKKCDHNLDCSDNSDKHGCYTTEEPAPQPNNTIGSIIG
VILTVFVVGAMYFICQRVLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGM
SRGKSVISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATERSHYT
MEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRVTTAVAKGYTSDL
NYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A151P774
XP_006267963.1.47583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]