SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006285284.1.15642 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006285284.1.15642
Domain Number 1 Region: 52-530
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.62e-139
Family Pyridoxal-dependent decarboxylase 0.00000000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006285284.1.15642
Sequence length 537
Comment hypothetical protein CARUB_v10006660mg [Capsella rubella]; AA=GCF_000375325.1; RF=representative genome; TAX=81985; STAX=81985; NAME=Capsella rubella; cultivar=Monte Gargano; AL=Scaffold; RT=Major
Sequence
MHYRDFGNVNCNGNGNGIGNGIGFGNSNGNGDVNGSNEKVNGANETIKMKPMDSELLREQ
GHIMVDFIADYYKNLQDSPQDFPVLSQVQPGYLRDMLPHSAPDQPDSLKKLLDDVTKKIM
PGLTHWQSPSYFAYYASSTSVAGFLGEMLSAGLSVVGFTWQTSPAATELEIIVLDWLAQL
LQLPDHFLSTGNGGGVIQGTACEAVLVVVLAARDRILKQVGKTSLPRLVVYASDQTHSSF
RKACLIGGIHEENIRVLKTDSSTNYGLPPESLEEAISHDLAKGFIPSFVCATVGTTSSAA
VDPLVPLGKIAKKNGIWMHVDAAYAGNACICPEYRKYIDGVENADSFNMNAHKWLFANQT
CSPLWVKDRYALIDALKTNPEYLDYKVSKRDEVVNYKDWQISLSRRFRSLKLWMVLRLYG
SENLRNFIREHVDLAKQFEAYVSQDPRFEVVTSRYFSLVCFRLVPLDADEDKCNQRNREL
LAAVNSTGKIFISHTALSGKFILRFAVGAPLTEEKHVTEAWQIIQKHASKFTCNGNC
Download sequence
Identical sequences R0F8D3
XP_006285284.1.15642 Carubv10006660m|PACid:20895672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]