SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006288169.1.15642 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006288169.1.15642
Domain Number 1 Region: 36-123
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.24e-29
Family B3 DNA binding domain 0.0000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006288169.1.15642
Sequence length 331
Comment hypothetical protein CARUB_v10001406mg [Capsella rubella]; AA=GCF_000375325.1; RF=representative genome; TAX=81985; STAX=81985; NAME=Capsella rubella; cultivar=Monte Gargano; AL=Scaffold; RT=Major
Sequence
MNMSTMNSEQELAENGAGGSGGGDNNYFYTAEMREHMFDKVLTPSDVGKLNRLVIPKQHA
ENYFPLEDNQNGTVLDFQDRNGRMWRFRYSYWNSSQSYVMTKGWSRFVKDKKLTSGDTVS
FHRGFIPDDNAPERRLKIMFIDWRHRDTHNNYGFGSPPYPTASFYPPPQYPMPLPSYRSF
PPFYHNQYQEREYLGYGYGRLVNGGRYYAGTPLDHHHHHQWSLGRSQPLVYESVPVFPAA
RAPPPPPAPPQPPITRRLRLFGVDVEESSPYVETRGEMGVAGHSSSSPVVIGDDDQLSWR
LPSGEVDASTSLPMQLSDDEDYKRKGKFSEY
Download sequence
Identical sequences R0FFQ7
Carubv10001406m|PACid:20911106 XP_006288169.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]