SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006340312.1.80749 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006340312.1.80749
Domain Number 1 Region: 7-169,198-350
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.58e-80
Family G proteins 0.00000124
Further Details:      
 
Domain Number 2 Region: 884-981
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 6.71e-25
Family EF-G/eEF-2 domains III and V 0.00044
Further Details:      
 
Domain Number 3 Region: 395-524
Classification Level Classification E-value
Superfamily Translation proteins 1.84e-23
Family Elongation factors 0.0013
Further Details:      
 
Domain Number 4 Region: 604-665,714-755,799-883
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.14e-22
Family Translational machinery components 0.026
Further Details:      
 
Domain Number 5 Region: 527-602
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.12e-16
Family EF-G/eEF-2 domains III and V 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006340312.1.80749
Sequence length 1023
Comment PREDICTED: elongation factor Tu GTP-binding domain-containing protein 1 [Solanum tuberosum]; AA=GCF_000226075.1; RF=representative genome; TAX=4113; STAX=4113; NAME=Solanum tuberosum; cultivar=DM 1-3 516 R44; AL=Scaffold; RT=Major
Sequence
MGDSDGEKIRNICILAHVDHGKTTLADHLIASSGGGVLHPKQAGKLRFMDYLDEEQRRAI
TMKSSSIGLKYKEHSINLIDSPGHMDFCSEVSTAARLSDGALVLVDAVEGVHIQTHAVLR
QAWIEKLTPCLVLNKIDRLIVELRLTPLEAYTRLQRIVHEVNSIVSAYKSEKYLSDVDSL
LSAPSGLVEDENPDLEFLEEDEEDTFQPQKGNVAFVCALDGWGFSISDFAEFYASKLGAS
SAALQKALWGPRYFNAKTKMIVGKKGISSGSKARPMFVQFVLEPLWQVYQAAVEADGDKG
MLEKVIKSFNLSIPPRELQNKDPKFVLQSVMSRWLPLSDTILSMAVKHMPDPISAQSFRI
SRLLPKRALLDMGVNPDVLSEAELVRKSVESCDSSPDAPCVVFVSKMFAIPSKMLPRGEI
MDDSGNGDSDECFLAFARIFSGVLHAGQKIFVLTALYDPLKEESMQKHVQEAELQSLYLM
MGQGLKPVASAKAGNVIAIRGLAQHILKSATLSSTLNCWPLSSMTFQVSPMLKVAIEPSD
PADMGALIKGLRLLNRADPFVEVSISARGEHVLAAAGEVHLERCIKDLKERFAKINLEVS
APLVSFKETIEGDTANPLENLKLLSRSSDYLEKETPNGRCVVRVRVMKLPTALTKLLDES
SELLEDIIGGKSLQACRSSETLRGNIVEDENPIEALKKRLIDAVESDFSTGFADTEKDRI
DKCKKTWQKFLKRIWALGPNQVGPNILLTPDVKGKSDDVSVLIKGSPYVSKKLGFTDDND
DSSASPESSTSVDPTLLREAENLESSILSGFQLATASGPLCDEPMWGLAFVIEASISPLA
TQPNDSDTPIPQLEQYGLFPGQVMTVVKDACRAAVLQRKPRLVEAMYFCELNTPHDQLGN
TYTVLNRRRAHVVNEEMLEGSSLFTVHAYVPVAESFGFSDELRRKTSGAASALLVLSHWE
ALPEDPFFVPRTEEEKEEFGDGASVPQSIARKLMDSVRRKKGLPVEEKVVQFATKQRTLA
RKV
Download sequence
Identical sequences M0ZTG0
XP_006340312.1.80749 PGSC0003DMP400005371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]