SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006348840.1.80749 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006348840.1.80749
Domain Number 1 Region: 56-263
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.89e-54
Family G proteins 0.00018
Further Details:      
 
Domain Number 2 Region: 205-358
Classification Level Classification E-value
Superfamily Translation proteins 1.33e-25
Family Elongation factors 0.0061
Further Details:      
 
Domain Number 3 Region: 457-572
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.11e-21
Family EF-G/eEF-2 domains III and V 0.016
Further Details:      
 
Domain Number 4 Region: 363-446
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.000000000451
Family EF-G/eEF-2 domains III and V 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006348840.1.80749
Sequence length 666
Comment PREDICTED: GTP-binding protein TypA/BipA homolog [Solanum tuberosum]; AA=GCF_000226075.1; RF=representative genome; TAX=4113; STAX=4113; NAME=Solanum tuberosum; cultivar=DM 1-3 516 R44; AL=Scaffold; RT=Major
Sequence
MVGPLIRSLWSTTRRSFSSSHYSHIKPLSYARAFSTATATAPVGSAATAPGGALDPDRLR
NVAVIAHVDHGKTTLMDRLLRQCGADIPHERALDSIDLERERGITIASKVTSISWKDKEL
NMVDTPGHADFGGEVERVVGMVEGAVLVVDAGEGPLAQTKFVLAKALKYGLRPILLLNKV
DKPAVTEERCNEVESLVFDLFANLGASEEQLDFPVLYASAKEGWASSTYTKSPPDVKDMS
QLLNAIVGHVPPPSASLDAPFQMLVSMMEKDPYLGRVLTGRVTCGVVRVGDKVQGLKNTD
NGTVKIEEGKVVKLMKKKGMRADPVDSAGAGDIVSMAGLSSPTIGHTVANAEVTTALPTV
VLDPPTISMTFGVNDSPLAGSDGIHLTGGKIGDRLLAESETNLAINVLPSTTESFEVQGR
GELQLGILIENMRREGFELSVSPPKVMYKVEKGTKLEPIEEVTIEVDDEHVGLVMEALSH
RRGEVTDMGPVPGSMGRTRMCLTCPSRGLVGYRSVFSSDTRGSGFMHRAFLTYEKYRGPL
GNVRKGVLVSMGRGLITAHALMGLEARGVLFVAPAMETYDGMIIGEHSRDTDLDVNPVKS
KELNNIRCASKDENVKLTPPRLMSLEEAIGYVASDELIEVTPKAIRLRKRYLEVNKRKSM
SKRPKD
Download sequence
Identical sequences M1AJW7
PGSC0003DMP400016623 XP_006348840.1.80749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]