SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006392384.1.70970 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006392384.1.70970
Domain Number 1 Region: 15-76
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000765
Family B3 DNA binding domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006392384.1.70970
Sequence length 79
Comment hypothetical protein EUTSA_v10024065mg, partial [Eutrema salsugineum]; AA=GCF_000478725.1; RF=representative genome; TAX=72664; STAX=72664; NAME=Eutrema salsugineum; AL=Scaffold; RT=Major
Sequence
MEEEARIIHEKYLKIRKTGLIVVLVDPLSKRHVVDLRKWKISGNLVYVISTGWWDMVIAN
KFKVGDVYPVWYFRFGQAK
Download sequence
Identical sequences V4JW57
Thhalv10024065m|PACid:20200950 XP_006392384.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]