SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006396490.1.70970 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006396490.1.70970
Domain Number 1 Region: 5-103
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.18e-21
Family B3 DNA binding domain 0.00025
Further Details:      
 
Domain Number 2 Region: 325-406
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000824
Family B3 DNA binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006396490.1.70970
Sequence length 411
Comment hypothetical protein EUTSA_v10028696mg [Eutrema salsugineum]; AA=GCF_000478725.1; RF=representative genome; TAX=72664; STAX=72664; NAME=Eutrema salsugineum; AL=Scaffold; RT=Major
Sequence
MDATDTPPRFFKVFISHFSSDSMLIPISYYDELPRLLPETAILQGTGGCSWNVAMNLKEE
EVCFEQGWPEFVKDNSLIDGDFLTFVYNGDSVFEVSIYGLHGCKENRAVTEVEEDDKEDS
TCFLSSDDTNTSSESEMATAIPRSKNKGKEEDSDDSDDSVHSLNSEDTETETEKNKGKPK
EKVMEEDIDFSLDSEETETEGSEFKNVNTIRRSKNKGKKKVEVVESSDEDTDSDYIEAFS
RLDFEENSNSDSSYSPDCEDTSAHVKPKVTNPKKKGKSIVSTGESSHRVEPSKRREKVKR
KIKNPEVYLDDPNNVHFETGVKNRKYELLVHAQLVKDYCLRFQEYISYIDPKGKLEAKTA
RWRDQRVCIKRWKRICDRNKLKKNDRIVCEILRNQDLVYAIKVHIVRGIYL
Download sequence
Identical sequences V4LDS2
Thhalv10028696m|PACid:20196953 XP_006396490.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]