SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006400343.1.70970 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006400343.1.70970
Domain Number 1 Region: 14-118
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-21
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 203-294
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-18
Family B3 DNA binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006400343.1.70970
Sequence length 352
Comment hypothetical protein EUTSA_v10015705mg [Eutrema salsugineum]; AA=GCF_000478725.1; RF=representative genome; TAX=72664; STAX=72664; NAME=Eutrema salsugineum; AL=Scaffold; RT=Major
Sequence
MVKNSGFGQIMQEGDNPGFFKILRKEDLSSEIMRMIPHQFIRSISDNSSSFKMVLKLPWG
SSWPVKISKNPSFHYMEDRGWNRFVSDNALGENEYLTFTHEANMCFNVNIYEPDGTEMLR
PRESATIASSSGLNKREQRKEVKTEEIIESSSESSYPGLNKAESAGSRLKKKRELNLGKK
KAEKTGKPKKKKVDSAAGTSSLVPEFNLTIKKSHLLYFAIPKNFVDMHMPKKTKLFKIHP
EGENSWEVLYLVTGVQSRFSAGWSRLAKDLGLVVGDVCTFKLIKPTEMLLKVSRDGDDDA
DDDDDDADDDDDDDADDDDDDADDDDDDADDDDDDDDDDDDDDDDDDDDDDV
Download sequence
Identical sequences V4N7Z1
Thhalv10015705m|PACid:20206714 XP_006400343.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]