SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006405006.1.70970 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006405006.1.70970
Domain Number 1 Region: 288-388
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-24
Family B3 DNA binding domain 0.0048
Further Details:      
 
Domain Number 2 Region: 443-541
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.65e-19
Family B3 DNA binding domain 0.0071
Further Details:      
 
Domain Number 3 Region: 3-105
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.83e-19
Family B3 DNA binding domain 0.004
Further Details:      
 
Domain Number 4 Region: 135-232
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.14e-18
Family B3 DNA binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006405006.1.70970
Sequence length 549
Comment hypothetical protein EUTSA_v10000111mg [Eutrema salsugineum]; AA=GCF_000478725.1; RF=representative genome; TAX=72664; STAX=72664; NAME=Eutrema salsugineum; AL=Scaffold; RT=Major
Sequence
MANKHFFKPLLPGFHSHLTIPVAFFLKYIKGTNEQKKTTAKLRSDASDITWEVKIEDGQK
LTDGWKEFVLAHDLRVGDIAIFRQEKDMAFHVTLMGPSCCEIQYESGLDDENNLGKIPKK
TKVKKNPRKETESSSLDPSCFVAHVTHASLRYDSLNLPMSFARANGLNTRCGEIVLMNDK
GRSWTLALKQKKCGSTYIRRGWRTFCSANGFKAGEAFTFKLIQRGKVPVLRLSTTESEEE
EESSGADEVESLSTEPESDEESNLAEIQRRKKLKKNPERETESYPLDPSYFVAKVSPSTL
RQDRLYLPRNFSRENGLDTRCGEIVLMNEMGRSWTLNLKRKNSCGTAYIRRGWRSFCRAN
GLRAGDSITFKLIQRGGTLVLRLSPTDSEEEEEEEEEEEEEESSEGDEIESLSTEQESDE
EGNQDEKSFKKPRLLWKASSTPSQNRFVTLTLKPFNLTKYVMLLPIPFTRMHGINEETKM
SLVDKHGVRWSTNLRSEITGDRIRMVGGWQEFFKANCVKIGESVMLKLIWEGDKSCVLKF
CSKLKQVTK
Download sequence
Identical sequences V4LRK3
Thhalv10000111m|PACid:20208496 XP_006405006.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]