SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006413228.1.70970 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006413228.1.70970
Domain Number 1 Region: 267-373
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.56e-18
Family Ankyrin repeat 0.00085
Further Details:      
 
Domain Number 2 Region: 66-193
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000502
Family BTB/POZ domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006413228.1.70970
Sequence length 593
Comment hypothetical protein EUTSA_v10024745mg [Eutrema salsugineum]; AA=GCF_000478725.1; RF=representative genome; TAX=72664; STAX=72664; NAME=Eutrema salsugineum; AL=Scaffold; RT=Major
Sequence
MDNIAGFSDSYEISNTSSTSFFATPAPTEKTESSIVYPSEVLAGPEVSAYRLLSNSFESV
FDSPEAFYSDAYLVLADGREVSFHRCVLSARSPFFKSALAAAEKEQKSTVAKLELKKIAT
DYDVGFDSVVAVLAYVYCGRVRPPPKGVSECADDNCCHVACRPAVDFMVEVLYLAFVFEI
PELITLYQRHLLDVVDKVIVEDTLFILKLANICGKTCMKLLEKCREIIVKSNVDIVSLKK
SLPQHIVKQIVDIRKELGFEAPEPEKHVSNIHKALESDDVALVVMLLNEGHTNLDDAYAL
HFAVAYCDVKTATDLLKLELADVNHRNARGYTVLHVAAMRKEPNLIALLLTKGANASEIS
FDGRTALLIAKQVTKAAEYNYIPEQGKPSSKGRLCVEILEQPDKRDPFPADVSPSLAEAA
DVLKIRLIDLENRVQMARCLFPMEAQVAMDIAQMNGTCEFVVTSLDDCLIGGKRASPDQY
MAPFEILETHRSRLRALSKTVEFGKRFFPRCSAELDEIMDSEDLSILACIEEDTPEQRLQ
KRQRYMEIQKNLQNAFSKDKEELGKSSPSASSSSTSKSTATKGSNGKLSHRRR
Download sequence
Identical sequences V4P5B6
Thhalv10024745m|PACid:20193836 XP_006413228.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]