SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006417140.1.70970 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006417140.1.70970
Domain Number 1 Region: 179-288
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.66e-33
Family B3 DNA binding domain 0.00000136
Further Details:      
 
Domain Number 2 Region: 55-112
Classification Level Classification E-value
Superfamily DNA-binding domain 2.68e-17
Family GCC-box binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006417140.1.70970
Sequence length 340
Comment hypothetical protein EUTSA_v10010019mg [Eutrema salsugineum]; AA=GCF_000478725.1; RF=representative genome; TAX=72664; STAX=72664; NAME=Eutrema salsugineum; AL=Scaffold; RT=Major
Sequence
MEVSSVDESTTSTGSICETPAKKSSVNLYRMGSGSSVVLDSENGVEAESRKLPSSKYKGV
VPQPNGRWGAQIYEKHQRVWLGTFNEEDEAARAYDVAVHRFRGRDAVTNFKDARLDDGEI
DFLNSHSKSEIVDMLRKHTYKEELEQSKRRRNGNGNTVRTSMTAALDNDDGVSTMEFRSA
EPLFEKAVTPSDVGKLNRLVIPKHHAEKHFPLPSSNVSVKGVLLNFEDVTGKVWRFRYSY
WNSSQSYVLTKGWSRFVKEKNLRAGDVVSFSRSDGQDQQLYIGWKSRSGSDSETGRVLRL
FGVNISPESSRNDVVGSKRVNDTEMLSLVCSKKQRIFHAS
Download sequence
Identical sequences V4L6Y3
XP_006417140.1.70970 Thhalv10010019m|PACid:20188671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]