SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006423121.1.91645 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006423121.1.91645
Domain Number 1 Region: 5-106
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.65e-21
Family B3 DNA binding domain 0.0024
Further Details:      
 
Domain Number 2 Region: 253-347
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-16
Family B3 DNA binding domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006423121.1.91645
Sequence length 349
Comment hypothetical protein CICLE_v10028745mg [Citrus clementina]; AA=GCF_000493195.1; RF=representative genome; TAX=85681; STAX=85681; NAME=Citrus clementina; cultivar=Clemenules; AL=Scaffold; RT=Major
Sequence
MPSSMKKTYPHFIDVILDSTIEDKKMKIPQNFVGRFGDELSNVATLTNPEGYVMRVGITR
KDGNIWFDGGWNEFVEDHSIDVGYFVLFQYRKNSKFRVFIYNTTTCEIQYPSRNTFPPPR
QNQATFDGSKSKNGCEMRGKTYRMEEVKVKEESDNVNDSMQDVIGTCNSEGSVHAKIHLS
ETQCSSVQETDLKIDSTKFKKAKHNLKDELRADSVDRVKLFALLEDMDIHICESRMTLEE
RQEAINVARLLKPEKPSFLVFLRASNMQLNYVYVPTSFARKYLNGEECVTVQDSDGRKLA
VKVKQSRRKYLLTRWGKFFKKTNVKEGDILFFEMIQMKKILLKVSVFNA
Download sequence
Identical sequences V4SH65
clementine0.9_014503m|PACid:19252671 clementine0.9_014528m|PACid:19252673 clementine0.9_014540m|PACid:19252672 XP_006423121.1.91645 XP_006423122.1.91645 XP_006423123.1.91645 XP_006479377.1.29302 XP_006479378.1.29302 XP_006479379.1.29302 XP_015386267.1.29302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]