SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006434876.1.91645 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006434876.1.91645
Domain Number 1 Region: 172-270
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.89e-23
Family B3 DNA binding domain 0.0073
Further Details:      
 
Domain Number 2 Region: 6-71
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000412
Family B3 DNA binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006434876.1.91645
Sequence length 358
Comment hypothetical protein CICLE_v10000881mg [Citrus clementina]; AA=GCF_000493195.1; RF=representative genome; TAX=85681; STAX=85681; NAME=Citrus clementina; cultivar=Clemenules; AL=Scaffold; RT=Major
Sequence
MEGRTSGSVTLIGPSWDTWHIDLIQQDDNLFFDKGWPVFLRDNFIECGDLLVFRYDGELH
FTVQIFDQSGCEKEAAFNSKSTSTGQKREREEAVAHSDKALQSLLKKIRECSSSFESDCI
DDNRDREADSCEETRRCLSLSTIFASPSQPKTCNIKPEDEEKKVAQSFISAFPYFVRKMK
RFNVSGSYTLNIPYQFSMAHLPNFKTEVVLHNLKGASWTVNSVPTTKVHTSHTFCGGWLA
FVRGNEIKLGDICIFELVHKCELHVYILRVGKQYPDSQRGTTVLTGSNVSSTTISCKQFD
GVPKKVKKNSLKKIQLCNVKGSKSCEIKKHIGTDGNSVSIATCCLPKISHEKSGKAVN
Download sequence
Identical sequences V4T9C4
XP_006434875.1.91645 XP_006434876.1.91645 clementine0.9_014026m|PACid:19274455 clementine0.9_014032m|PACid:19274457 clementine0.9_014056m|PACid:19274456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]