SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006451499.1.91645 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006451499.1.91645
Domain Number 1 Region: 262-368
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.44e-17
Family Ankyrin repeat 0.0018
Further Details:      
 
Domain Number 2 Region: 50-186
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000408
Family BTB/POZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006451499.1.91645
Sequence length 574
Comment hypothetical protein CICLE_v10007832mg [Citrus clementina]; AA=GCF_000493195.1; RF=representative genome; TAX=85681; STAX=85681; NAME=Citrus clementina; cultivar=Clemenules; AL=Scaffold; RT=Major
Sequence
MDNRNGFSDSNEISNNSRTSCVAAAANTESFYSSEPVNSDITALRILSKTLETIFESQDF
DYFTDAKIVLSTGREVPVHRCILSSRSGFFKNVFAGTGKQRGPKFELKELVRDYEVGFDP
LVAVLAYLYCGKVRPFPIGVCVCVDDDACSHVACRPAVDFMVEVLYVSFAFQVPELVALY
QRHLLDILDKVVADDILVVLSVAHMCGKACEKLLERCIEITVKSDIDIVTLDKTLPQHIV
KQIIDLRVELSLHRSESCGFPDKHTKRIHRALDSDDVELVRMLLKEAHTNLDDAHALHYA
VAYCDAKTTTELLDLGLADVNHRNSRGYTVLHVAAMRKEPKIIVSLLTKGARPSDLTLDG
RKALQISKRLTKAADYYIPTEEGKTTPKDRLCIEILEQAERRDPLLREASHSFAMAGDDL
RMKLLYLENRAKVIMDIVHLDGTLEFALDGIKTKKMAGAQRTTVDLNEAPFKMQEEHLNR
MKALCRTVELGKRFFPRCSEVLNKIMDADDLNQLACPGNDTPEERLLKRIRYMELQEVVS
KAFNEDKEEFDRSAISSSSSSKSVVRPRGGKRTH
Download sequence
Identical sequences V4WE04
clementine0.9_006073m|PACid:19254920 XP_006451499.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]