SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006510770.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006510770.1.92730
Domain Number 1 Region: 206-453
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.96e-86
Family Eukaryotic proteases 0.0000763
Further Details:      
 
Domain Number 2 Region: 110-213
Classification Level Classification E-value
Superfamily SRCR-like 3.79e-17
Family Hepsin, N-terminal domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006510770.1.92730
Sequence length 455
Comment PREDICTED: transmembrane protease serine 5 isoform X1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MSPTLDDQSPMEIRCTEEGAGPGIFRMELGDQRQSISQSQRWCCLQRGCVILGVLGLLAG
AGIASWLLVLYLWPAASPSISGTLQEEEMTLNCPGVSREEELLPSLPKTVSFRINGEDLL
LQVQVRARPDWLLVCHEGWSPALGMHICKSLGHIRLTQHKAVNLSDIKLNRSQEFAQLSA
RPGGLVEESWKPSANCPSGRIVSLKCSECGARPLASRIVGGQAVASGRWPWQASVMLGSR
HTCGASVLAPHWVVTAAHCMYSFRLSRLSSWRVHAGLVSHGAVRQHQGTMVEKIIPHPLY
SAQNHDYDVALLQLRTPINFSDTVGAVCLPAKEQHFPWGSQCWVSGWGHTDPSHTHSSDT
LQDTMVPLLSTYLCNSSCMYSGALTHRMLCAGYLDGRADACQGDSGGPLVCPSGDTWHLV
GVVSWGRGCAEPNRPGVYAKVAEFLDWIHDTVQVR
Download sequence
Identical sequences Q9ER04
XP_006510770.1.92730 ENSMUSP00000064527 ENSMUSP00000132181 ENSMUSP00000132181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]