SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006511548.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006511548.1.92730
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 6.67e-30
Family N-terminal domain of MutM-like DNA repair proteins 0.000000419
Further Details:      
 
Domain Number 2 Region: 133-244
Classification Level Classification E-value
Superfamily S13-like H2TH domain 2.5e-26
Family Middle domain of MutM-like DNA repair proteins 0.0000022
Further Details:      
 
Domain Number 3 Region: 248-290
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.42e-19
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006511548.1.92730
Sequence length 389
Comment PREDICTED: endonuclease 8-like 1 isoform X1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MPEGPELHLASHFVNETCKGLVFGGCVEKSSVSRNPEVPFESSAYHISALARGKELRLTL
SPLPGSQPPQKPLSLVFRFGMSGSFQLVPAEALPRHAHLRFYTAPPAPRLALCFVDIRRF
GHWDPGGEWQPGRGPCVLLEYERFRENVLRNLSDKAFDRPICEALLDQRFFNGIGNYLRA
EILYRLKIPPFEKARTVLEALQQCRPSPELTLSQKIKAKLQNPDLLELCHLVPKEVVQLG
GKGYGPERGEEDFAAFRAWLRCYGVPGMSSLRDRHGRTIWFQGDPGPLAPKGGRSQKKKS
QETQLGAEDRKEDLPLSSKSVSRMRRARKHPPKRIAQQSEGAGLQQNQETPTAPEKGKRR
GQRASTGHRRRPKTIPDTRPREAGESSAS
Download sequence
Identical sequences Q8K4Q6
ENSMUSP00000034842 ENSMUSP00000139917 ENSMUSP00000141048 10090.ENSMUSP00000034842 ENSMUSP00000034842 NP_082623.1.92730 XP_006511548.1.92730 XP_006511549.1.92730 XP_011241120.1.92730 ENSMUSP00000034842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]