SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006529414.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006529414.1.92730
Domain Number 1 Region: 2-52
Classification Level Classification E-value
Superfamily LEM domain 6.28e-16
Family LEM domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006529414.1.92730
Sequence length 129
Comment PREDICTED: LEM domain-containing protein 1 isoform X2 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MVDVKCLSDYELHKHLMKLGFTPGPILPSTRKTYEKKLVQLLASPPWKPPVMKRPTRPHG
SEDSDDSEGMLQDQVQGLSGDVSLKKTTLDATRDPRAAPHTRTPGTTFHARTLRTAFCGR
APRTTSHGA
Download sequence
Identical sequences Q14C37
ENSMUSP00000107976 10090.ENSMUSP00000107976 ENSMUSP00000107976 NP_001028422.2.92730 XP_006529414.1.92730 ENSMUSP00000107976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]