SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006529763.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006529763.1.92730
Domain Number 1 Region: 525-553,660-737
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000314
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006529763.1.92730
Sequence length 790
Comment PREDICTED: solute carrier family 26 member 9 isoform X1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MNQPRPRYVVDRAAYSLSLFDDEFEKKDRAYPVGEKLRNTFRCSSAKFKAFVFGLLPVLS
WLPKYKIKDYIIPDLLGGLSGGCIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGI
HQMVPGTFAVISILVGNICLQLAPESKFQIFNNVTNETYVDTAAMEAERLHVSATLACLT
AVIQMALGFMQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFGLTIPSYTGPGSIVFT
FIDICKNLPHTNIASLIFALVSGVFLVLVKELNARYMHKIHFPIPTEMIVVVVATAISGS
CKMPKKYHMQIVGEIRQGFPTPVAPMVSQWKDMVGTAFSLAIVGYVINLAMGRTLASKHG
YDVDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVASLCVSLVVMITML
VLGSYLYPLPKAVLGALIAVNLKNSLKQLTDPYYLWRKSKLDCCVWVVSFLSSFFLSLPY
GVAVGVAFSILVVIFQTQFRNGSTLAQVMDTDIYVNPKTYNRAQEIAGVKIVTYCSPLYF
ANSEIFRQKVIAKTGMDPQKVLLAKQKYLRKQEKRTAIPTQQRKSLFMKTKTVSLQELQQ
DFESAPSTDPNNNQAPAAEAHISYITFSPDASTAAACELPASTRSPQEASDTLASVPPFV
TFHTLILDMSGVSFVDLMGIKALAKLSSTYEKIGVQIFLVNIHAQVYNDISHGGVFEDGC
VQRSHVFPSIHDAVLFAQANAREAPDRNFHGAPGDTEFSLYDSEEEGPSYWDLEQEMFGT
MFHTETLTAL
Download sequence
Identical sequences A0A0R4J0F7
ENSMUSP00000036916 10090.ENSMUSP00000036916 ENSMUSP00000036916 ENSMUSP00000036916 NP_796217.2.92730 XP_006529763.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]