SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006531893.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006531893.1.92730
Domain Number 1 Region: 6-436
Classification Level Classification E-value
Superfamily ALDH-like 1.7e-125
Family ALDH-like 0.000000000555
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006531893.1.92730
Sequence length 468
Comment PREDICTED: aldehyde dehydrogenase family 3 member B1 isoform X1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MDSFEDKLQQLREAFKEGRTRSAEFRAAQLQGLSHFLRDNKQQLQEALAQDLHKSAFEAE
VSEIAISQAEVDLALRNLRSWMKDEKVSKNLATQLDSAFIRKEPFGLVLIIVPWNYPINL
TLVPLVGAIAAGNCVVLKPSEISKATEKILAEVLPRYLDQSCFTVVLGGRQETGQLLEHK
FDYIFFTGNAYVGKIVMAAAAKHLTPITLELGGKNPCYVDDNCDPQIVANRVAWFRYFNA
GQTCVAPDYILCSQEMQERLVPALQNAITRFYGDNPQTSPNLGRIINQKHFKRLQGLLGC
GRVAIGGQSDEGERYIAPTVLVDVQETEPVMQEEIFGPILPLVTVRSLDEAIEFMNRREK
PLALYAFSKRSQVIKQVLARTSSGGFCGNDGFMHMTLSSLPFGGVGTSGMGRYHGKFSFD
TFSNQRACLLRSPGMEKINDLRYPPYSSRNLRVLLVAMEERCCSCTLL
Download sequence
Identical sequences Q3TX25 Q80VQ0
NP_080592.2.92730 XP_006531893.1.92730 10090.ENSMUSP00000056276 ENSMUSP00000056276 ENSMUSP00000056276 ENSMUSP00000056276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]