SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006532637.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006532637.1.92730
Domain Number 1 Region: 130-369
Classification Level Classification E-value
Superfamily vWA-like 9.64e-71
Family Integrin A (or I) domain 0.00000187
Further Details:      
 
Domain Number 2 Region: 1130-1314
Classification Level Classification E-value
Superfamily Fibronectin type III 1.04e-35
Family Fibronectin type III 0.00000309
Further Details:      
 
Domain Number 3 Region: 1457-1658
Classification Level Classification E-value
Superfamily Fibronectin type III 4.52e-35
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 4 Region: 992-1110
Classification Level Classification E-value
Superfamily CalX-like 7.06e-19
Family CalX-beta domain 0.00092
Further Details:      
 
Domain Number 5 Region: 626-711
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.57e-17
Family Integrin beta tail domain 0.0022
Further Details:      
 
Domain Number 6 Region: 28-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000167
Family Plexin repeat 0.0017
Further Details:      
 
Domain Number 7 Region: 539-577
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000474
Family Integrin beta EGF-like domains 0.02
Further Details:      
 
Domain Number 8 Region: 581-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000558
Family Integrin beta EGF-like domains 0.007
Further Details:      
 
Weak hits

Sequence:  XP_006532637.1.92730
Domain Number - Region: 509-540
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00558
Family Integrin beta EGF-like domains 0.036
Further Details:      
 
Domain Number - Region: 469-495
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0921
Family Integrin beta EGF-like domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006532637.1.92730
Sequence length 1753
Comment PREDICTED: integrin beta-4 isoform X6 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MAGPCCSPWVKLLLLAAMLSASLPGDLANRCKKAQVKSCTECIRVDKSCAYCTDELFKER
RCNTQAELLAAGCRGESILVMESSLEITENTQIDTSLHRSQVSPQGLQVRLRPGEERSFV
FQVFEPLESPVDLYILMDFSNSMSDDLDNLKQMGQNLAKILRQLTSDYTIGFGKFVDKVS
VPQTDMRPEKLKEPWPNSDPPFSFKNVISLTENVEEFWNKLQGERISGNLDAPEGGFDAI
LQTAVCTRDIGWRADSTHLLVFSTESAFHYEADGANVLAGIMNRNDEKCHLDASGAYTQY
KTQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHKYFPVSSLGVLQEDSSNIVELL
EEAFYRIRSNLDIRALDSPRGLRTEVTSDTLQKTETGSFHIKRGEVGTYNVHLRAVEDID
GTHVCQLAKEDQGGNIHLKPSFSDGLRMDASVICDVCPCELQKEVRSARCHFRGDFMCGH
CVCNEGWSGKTCNCSTGSLSDTQPCLREGEDKPCSGHGECQCGRCVCYGEGRYEGHFCEY
DNFQCPRTSGFLCNDRGRCSMGECVCEPGWTGRSCDCPLSNATCIDSNGGICNGRGYCEC
GRCHCNQQSLYTDTTCEINYSAIRLGLCEDLRSCVQCQAWGTGEKKGRACDDCPFKVKMV
DELKKAEEVVEYCSFRDEDDDCTYSYNVEGDGSPGPNSTVLVHKKKDCPPGSFWWLIPLL
IFLLLLLALLLLLCWKYCACCKACLGLLPCCNRGHMVGFKEDHYMLRENLMASDHLDTPM
LRSGNLKGRDTVRWKITNNVQRPGFATHAASTSPTELVPYGLSLRLGRLCTENLMKPGTR
ECDQLRQEVEENLNEVYRQVSGAHKLQQTKFRQQPNTGKKQDHTIVDTVLLAPRSAKQML
LKLTEKQVEQGSFHELKVAPGYYTVTAEQDARGMVEFQEGVELVDVRVPLFIRPEDDDEK
QLLVEAIDVPVGTATLGRRLVNITIIKEQASGVVSFEQPEYSVSRGDQVARIPVIRHILD
NGKSQVSYSTQDNTAHGHRDYVPVEGELLFHPGETWKELQVKLLELQEVDSLLRGRQVRR
FQVQLSNPKFGARLGQPSTTTVILGEHDETDRSLINQTLSSPPPPHGDLGAPQNPNAKAA
GSRKIHFNWLPPPGKPMGYRVKYWIQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCA
YGAQGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYG
LVNEDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLAT
QPKRPMSIPIIPDIPIVDAQGGEDYENFLMYSDDVLRSPASSQRPSVSDDTEHLVNGRMD
FAYPGSANSLHRMTAANVAYGTHLSPHLSHRVLSTSSTLTRDYHSLTRTEHSHSGTLPRD
YSTLTSLSSQDSRGAVGVPDTPTRLVFSALGPTSLKVSWQEPQCDRMLLGYSVEYQLLNG
GEMHRLNIPNPGQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQVHPQSPLC
PLPGSAFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDILGYLVTCEMAQGGAPART
FRVDGDNPESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQVGGPFPQLGSHS
GLFQNPVQSEFSSVTSTHSTTTEPFLMDGLTLGTQRLEAGGSLTRHVTQEFVTRTLTASG
SLSTHMDQQFFQT
Download sequence
Identical sequences XP_006532637.1.92730 ENSMUSP00000070811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]