SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006608635.1.66377 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006608635.1.66377
Domain Number 1 Region: 3-267
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.55e-99
Family Capz beta-1 subunit 0.00000000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006608635.1.66377
Sequence length 273
Comment PREDICTED: F-actin-capping protein subunit beta-like isoform X2 [Apis dorsata]; AA=GCF_000469605.1; RF=representative genome; TAX=7462; STAX=7462; NAME=Apis dorsata; AL=Scaffold; RT=Major
Sequence
MTEQQMDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIAKDKESGKDYL
LCDYNRDGDSYRSPWSNTYDPPLEDGSMPSERLRKLEIDANHAFDQYRELYFEGGVSSVY
LWDLDHGFAAVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRIAHYKLTSTAMLWLQTN
KHGSGTMNLGGSLTRQVEQDAQISENSPHIANIGRMVEDMENKIRNTLNEIYFGKTKDIV
NGLRSVQSLADQRQQAALRQDLAAALQRRNANN
Download sequence
Identical sequences A0A088ALS0 A0A2A3ERK9 V9IH62
7460.XP_393085 XP_003689805.1.59471 XP_006608635.1.66377 XP_393085.2.77095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]