SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006633698.1.81211 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006633698.1.81211
Domain Number 1 Region: 632-887
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-55
Family YWTD domain 0.00000366
Further Details:      
 
Domain Number 2 Region: 21-281
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-55
Family YWTD domain 0.00000125
Further Details:      
 
Domain Number 3 Region: 331-566
Classification Level Classification E-value
Superfamily YWTD domain 8.76e-50
Family YWTD domain 0.00000406
Further Details:      
 
Domain Number 4 Region: 935-1194
Classification Level Classification E-value
Superfamily YWTD domain 6.67e-42
Family YWTD domain 0.0000363
Further Details:      
 
Domain Number 5 Region: 1325-1363
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 1246-1286
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 7 Region: 890-937
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000261
Family EGF-type module 0.018
Further Details:      
 
Domain Number 8 Region: 587-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000351
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 9 Region: 1287-1323
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000471
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 10 Region: 283-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000914
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1204-1256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006633698.1.81211
Sequence length 1611
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 isoform X2 [Lepisosteus oculatus]; AA=GCF_000242695.1; RF=representative genome; TAX=7918; STAX=7918; NAME=Lepisosteus oculatus; AL=Chromosome; RT=Major
Sequence
MGAVLRSLLLCSFCSVIRGAPLLLYANRRDLRLVDAARGQGNATVVVSGLEDAAAVDFVY
SKGLIYWSDVSEEAIKRIVFNQSGSVHSVVVSGLVSPDGLACDWLGSKLYWTDSETNRIE
VSNLDGSLRKVLFWQDLDQPRAITLDPARGYMYWTDWGEVPKIERAGMDGTNRSIIIDRN
IYWPNGLTLDYIEKKLYWADAKYNFIHRSNLDGTSREVVVEGSLPHPFALTLFEDTLYWT
DWNTHSIHSCNKTSGSNRREVHTNIFSPMDIHVFNQKRQPASNNPCGENNGGCSHLCLMS
PVKPFHQCACPTGVQLLGDGKTCKDGASELLLLARRTDLRRISLDTPDFTDIILNLDDIR
HAIAIDYDPVEGHIYWTDDEVHAIRRSYLDGTGSQFLVTSQVNHPDGIAVDWIARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLDEPRAIVLDPMSGYMYWTDWGEIPKIERAALDGTD
RVVMVNTSLGWPNGLALDYAEKKIYWGDAKTDKIEVMSMDATGRRILVEDKLPHIFGFTL
LGDFIYWTDWQRRSIERVHKRTAEREIIIDQLPDLMGLKATNVHQIIGTNPCADENGGCS
HLCLYKPQGVQCACPIGLELISDMSTCIVPEAFLLFSRHTDIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDITLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
TGRITLVPNVGRANGLTIDYAERRLYWTDLDTTLIESSNMLGQEREVIADDLPHPFGLTQ
YQDYIYWTDWSQRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQGGWNACASTNGHC
SHLCLAVPVSSFVCGCPAHYSLNSDNKTCSAPTSFLLFSQKTAINRMVIDEQQSPDIILP
IHSLRNVRAIDYDPLDKHLYWIDSKQNVIRRAQEDGNQSMTVVSSAVTSHGLGMQPHDLS
IDIYSRFIYWTNEITNVINVTRTDGRRVGVVLRGEQDRPRAIVVNPERGYMYFTNLQDRS
PRIERAALDGTEREVLFFTGLGKPVALAIDNELGKLFWVDSDLRRIESSDLSGADRIVIE
DSNILQPVGLTVFGNHLYWIDRQQQMIERIDKVTREGRTKIQARIASLSDIHAVSELDMR
EYRKHPCTLENGGCSHICIVKGDGTTRCSCPVHLVLLPDELSCGEPPTCSPEQFSCSSGD
VDCIPQAWRCDGYPECDDGSDEEDCPVCSDTQFQCDSRQCVDIIMRCNGEINCQDKSDEN
KCEVLCPVDQFMCSNGQCIGKHKKCDHNTDCTDNSDELGCYPTEEPSPQPTNTIGSIIGV
ILALFVVGAMYFVCQRVLCPHMKDDGETMTNDFVVHGASSVPLGYVPHPNSLSGSLPGMS
RGKSVMSSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATERSHYTL
EFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYTPSRRIITAAKGYTSDLNY
DSEPFPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_006633698.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]