SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006654551.1.55871 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006654551.1.55871
Domain Number 1 Region: 129-225
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-23
Family B3 DNA binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006654551.1.55871
Sequence length 277
Comment PREDICTED: B3 domain-containing protein Os05g0481400-like [Oryza brachyantha]; AA=GCF_000231095.1; RF=representative genome; TAX=4533; STAX=4533; NAME=Oryza brachyantha; AL=Chromosome; RT=Major
Sequence
MAAEAGSAASGAAYEEERRKRVLENLKQLEDLGITKMSKSLLQAARLQKSTRASPKQRRK
FEATEVRRSSRARNSVSYKDDDFGELDSFLRRRRGSRNTEQGRDYTGRIASYEQQQSAFK
RAERLQNRLDPENPSFVKTMVRSHVSSCFWLGLPSRFCKLHLPPREFKMVLEDEEGGEFD
SVYIGNRTGLSGGWRGFAMHHNLEDCDSLVFELVEPDRFKIYIRKAYDEDADESESVDLE
ADGDKKDASAKDATEQNDSPNAESLKGAKRRKLRARR
Download sequence
Identical sequences J3M877
OB05G28010.1 XP_006654551.1.55871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]