SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006715470.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006715470.1.92137
Domain Number 1 Region: 12-149,180-286
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.99e-74
Family Calponin-homology domain, CH-domain 0.0000337
Further Details:      
 
Domain Number 2 Region: 8067-8222
Classification Level Classification E-value
Superfamily Spectrin repeat 3.24e-21
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 3 Region: 8469-8583
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-19
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 4 Region: 7847-7971
Classification Level Classification E-value
Superfamily Spectrin repeat 1.17e-18
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 5 Region: 1633-1768
Classification Level Classification E-value
Superfamily Spectrin repeat 1.22e-17
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 6 Region: 6986-7127
Classification Level Classification E-value
Superfamily Spectrin repeat 5.55e-17
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 7 Region: 3343-3465
Classification Level Classification E-value
Superfamily Spectrin repeat 1.1e-16
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 8 Region: 4517-4674
Classification Level Classification E-value
Superfamily Spectrin repeat 1.36e-16
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 9 Region: 7439-7570
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-16
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 10 Region: 7100-7244
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000017
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 11 Region: 2469-2599
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000755
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 12 Region: 4299-4455
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000106
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 13 Region: 3771-3892
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000113
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 14 Region: 5057-5215
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000131
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 15 Region: 3127-3251
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000298
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 16 Region: 7975-8085
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000662
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 17 Region: 6798-6916
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000851
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 18 Region: 3899-4013
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000103
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 19 Region: 567-709
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000322
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 20 Region: 2687-2813
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000519
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 21 Region: 7366-7473
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000119
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 22 Region: 3577-3709
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000183
Family Spectrin repeat 0.0083
Further Details:      
 
Domain Number 23 Region: 7637-7787
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000185
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 24 Region: 1415-1549
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000644
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 25 Region: 2841-2958
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000229
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 26 Region: 5741-5818,5929-5975
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000288
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 27 Region: 2257-2412
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000276
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 28 Region: 5938-6081
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000446
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 29 Region: 4968-5091
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000497
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 30 Region: 1098-1236
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000115
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 31 Region: 5483-5602
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000152
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 32 Region: 1933-2084
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000018
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 33 Region: 8546-8706
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000187
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 34 Region: 1554-1664
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000222
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 35 Region: 5185-5289
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000224
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 36 Region: 1723-1874
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000295
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 37 Region: 3470-3575
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000089
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 38 Region: 5607-5697
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000144
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 39 Region: 3042-3140
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000056
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 40 Region: 6091-6203
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000017
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 41 Region: 4216-4344
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000216
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 42 Region: 6569-6653
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000246
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 43 Region: 2060-2163
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000458
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 44 Region: 3254-3355
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000547
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 45 Region: 4011-4143
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000838
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 46 Region: 4886-4997
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000968
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 47 Region: 6393-6498
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000013
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 48 Region: 897-1023
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000155
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 49 Region: 2162-2286
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000432
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006715470.1.92137
Sequence length 8846
Comment PREDICTED: nesprin-1 isoform X1 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MATSRGASRCPRDIANVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDG
VKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEGRKSMHRGSPIKLVNINSTD
IADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSIVSSETPSPPSKRKVT
TKIQGNAKKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELVDLETVKGR
SNRENLEDAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDIHNASTDGQ
EDDEILPGFPSFANSVQNFKREDRVIFKEMKVWIEQFERDLTRAQMVESNLQDKYQSFKH
FRVQYEMKRKQIEHLIQPLHRDGKLSLDQALVKQSWDRVTSRLFDWHIQLDKSLPAPLGT
IGAWLYRAEVALREEITVQQVHEETANTIQRKLEQHKDLLQNTDAHKRAFHEIYRTRSVN
GIPVPPDQLEDMAERFHFVSSTSELHLMKMEFLELKYRLLSLLVLAESKLKSWIIKYGRR
ESVEQLLQNYVSFIENSKFFEQYEVTYQILKQTAEMYVKADGSVEEAENVMKFMNETTAQ
WRNLSVEVRSVRSMLEEVISNWDRYGNTVASLQAWLEDAEKMLNQSENAKKDFFRNLPHW
IQQHTAMNDAGNFLIETCDEMVSRDLKQQLLLLNGRWRELFMEVKQYAQADEMDRMKKEY
TDCVVTLSAFATEAHKKLSEPLEVSFMNVKLLIQDLEDIEQRVPVMDAQYKIITKTAHLI
TKESPQEEGKEMFATMSKLKEQLTKVKECYSPLLYESQQLLIPLEELEKQMTSFYDSLGK
INEIITVLEREAQSSALFKQKHQELLACQENCKKTLTLIEKGSQSVQKFVTLSNVLKHFD
QTRLQRQIADIHVAFQSMVKKTGDWKKHVETNSRLMKKFEESRAELEKVLRIAQEGLEEK
GDPEELLRRHTEFFSQLDQRVLNAFLKACDELTDILPEQEQQGLQEAVRKLHKQWKDLQG
EAPYHLLHLKIDVEKNRFLASVEECRTELDRETKLMPQEGSEKIIKEHRVFFSDKGPHHL
CEKRLQLIEELCVKLPVRDPVRDTPGTCHVTLKELRAAIDSTYRKLMEDPDKWKDYTSRF
SEFSSWISTNETQLKGIKGEAIDTANHGEVKRAVEEIRNGVTKRGETLSWLKSRLKVLTE
VSSENEAQKQGDELAKLSSSFKALVTLLSEVEKMLSNFGDCVQYKEIVKNSLEELISGSK
EVQEQAEKILDTENLFEAQQLLLHHQQKTKRISAKKRDVQQQIAQAQQGEGGLPDRGHEE
LRKLESTLDGLERSRERQERRIQVTLRKWERFETNKETVVRYLFQTGSSHERFLSFSSLE
SLSSELEQTKEFSKRTESIAVQAENLVKEASEIPLGPQNKQLLQQQAKSIKEQVKKLEDT
LEEDIKTMEMVKTKWDHFGSNFETLSVWITEKEKELNALETSSSAMDMQISQIKVTIQEI
ESKLSSIVGLEEEAQSFAQFVTTGESARIKAKLTQIRRYGEELREHAQCLEGTILGHLSQ
QQKFEENLRKIQQSVSEFEDKLAVPIKICSSATETYKVLQEHMDLCQALESLSSAITAFS
ASARKVVNRDSCVQEAAALQQQYEDILRRAKERQTALENLLAHWQRLEKELSSFLTWLER
GEAKASSPEMDISADRVKVEGELQLIQALQNEVVSQASFYSKLLQLKESLFSVASKDDVK
MMKLHLEQLDERWRDLPQIINKRINFLQSVVAEHQQFDELLLSFSVWIKLFLSELQTTSE
ISIMDHQVALTRHKDHAAEVESKKGELQSLQGHLAKLGSLGRAEDLHLLQGKAEDCFQLF
EEASQVVERRQLALSHLAEFLQSHASLSGILRQLRQTVEATNSMNKNESDLIEKDLNDAL
QNAKALESAAVSLDGILSKAQYHLKIGSSEQRTSCRATADQLCGEVERIQNLLGTKQSEA
DALAVLKKAFQDQKEELLKSIEDIEERTDKERLKEPTRQALQQRLRVFNQLEDELNSHEH
ELCWLKDKAKQIAQKDVAFAPEVDREINRLEVTWDDTKRLIHENQGQCCGLIDLMREYQN
LKSAVSKVLENASSVIVTRTTIKDQEDLKWAFSKHETAKNKMNYKQKDLDNFTSKGKHLL
SELKKIHSSDFSLVKTDMESTVDKWLDVSEKLEENMDRLRVSLSIWDDVLSTRDEIEGWS
NNCVPQMAENISNLDNHLRAEELLKEFESEVKNKALRLEELHSKVNDLKELTKNLETPPD
LQFIEADLMQKLEHAKEITEVAKGTLKDFTAQSTQVEKFINDITTWFTKVEESLMNCAQN
ETCEALKKVKDIQKELQSQQSNISSTQENLNSLCRKYHSAELESLGRAMTGLIKKHEAVS
QLCSKTQASLQESLEKHFSESMQEFQEWFLGAKAAAKESSDRTGDSKVLEAKLHDLQNIL
DSVSDGQSKLDAVTQEGQTLYAHLSKQIVSSIQEQITKANEEFQAFLKQCLKDKQALQDC
ASELGSFEDQHRKLNLWIHEMEERFNTENLGESKQHIPEKKNEVHKVEMFLGELLAARES
LDKLSQRGQLLSEEGHGAGQEGRLCSQLLTSHQNLLRMTKEKLRSCQVALQEHEALEEAL
QSMWFWVKAIQDRLACAESTLGSKDTLEKRLSQIQDILLMKGEGEVKLNMAIGKGEQALR
SSNKEGQRVIQTQLETLKEVWADIMSSSVHAQSTLESVISQWNDYVERKNQLEQWMESVD
QKIEHPLQPQPGLKEKFVLLDHLQSILSEAEDHTRALHRLIAKSRELYEKTEDESFKDTA
QEELKTQFNDIMTVAKEKMRKVEEIVKDHLMYLDAVHEFTDWLHSAKEELHRWSDMSGDS
SATQKKLSKIKELIDSREIGASRLSRVESLAPEVKQNTTASGCELMHTEMQALRADWKQW
EDSVFQTQSCLENLVSQMALSEQEFSGQVAQLEQALEQFSALLKTWAQQLTLLEGKNTDE
EIVECWHKGQEILDALQKAEPRTEDLKSQLNELCRFSRDLSTYSGKVSGLIKEYNCLCLQ
ASKGCQNKEQILQQRFRKAFRDFQQWLVNAKITTAKCFDIPQNISEVSTSLQKIQEFLSE
SENGQHKLNMMLSKGELLSTLLTKEKAKGIQAKVTAAKEDWKNFHSNLHQKESALENLKI
QMKDFEVSAEPIQDWLSKTEKMVHESSNRLYDLPAKRREQQKLQSVLEEIHCYEPQLNRL
KEKAQQLWEGQAASKSFRHRVSQLSSQYLALSNLTKEKVSRLDRIVAEHNQFSLGIKELQ
DWMTDAIHMLDSYCHPTSDKSVLDSRTLKLEALLSVKQEKEIQMKMIVTRGESVLQNTSP
EGIPTIQQQLQSVKDMWASLLSAGIRCKSQLEGALSKWTSYQDGVRQFSGWMDSMEANLN
ESERQHAELRDKTTMLGKAKLLNEEVLSYSSLLETIEVKGAGMTEHYVTQLELQDLQERY
RAIQERAKEAVTKSEKLVRLHQEYQRDLKAFEVWLGQEQEKLDQYSVLEGDAHTHETTLR
DLQELQVHCAEGQALLNSVLHTREDVIPSGIPQAEDRALESLRQDWQAYQHRLSETRTQF
NNVVNKLRLMEQKFQQVDEWLKTAEEKVSPRTRRQSNRATKEIQLHQMKKWHEEVTAYRD
EVEEVGARAQEILDESHVNSRMGCQATQLTSRYQALLLQVLEQIKFLEEEIQSLEESESS
LSSYSDWYGSTHKNFKNVATKIDKVDTVMMGKKLKTLEVLLKDMEKGHSLLKSAREKGER
AVKYLEEGEAERLRKEIHDHMEQLKELTSTVRKEHMTLEKGLHLAKEFSDKCKALTQWIA
EYQEILHVPEEPKMELYEKKAQLSKYKSLQQTVLSHEPSVKSVREKGEALLELVQDVTLK
DKIDQLQSDYQDLCSIGKEHVFSLEAKVKDHEDYNSELQEVEKWLLQMSGRLVAPDLLET
SSLETITQQLAHHKAMMEEIAGFEDRLNNLQMKGDTLIGQCADHLQAKLKQNVHAHLQGT
KDSYSAICSTAQRMYQSLEHELQKHVSRQDTLQQCQAWLSAVQPDLEPSPQPPLSRAEAI
KQVKHFRALQEQARTYLDLLCSMCDLSNASVKTTAKDIQQTEQTIEQKLVQAQNLTQGWE
EIKHLKSELWIYLQDADQQLQNMKRRHSELELNIAQNMVSQVKDFVKKLQSKQASVNTII
EKVNKLTKKEESPEHKEINHLNDQWLDLCRQSNNLCLQREEDLQRTRDYHDCMNVVEVFL
EKFTTEWDNLARSDAESTAVHLEALKKLALALQERKYAIEDLKDQKQKMIEHLNLDDKEL
VKEQTSHLEQRWFQLEDLIKRKIQVSVTNLEELNVVQSRFQELMEWAEEQQPNIAEALKQ
SPPPDMAQNLLMDHLAICSELEAKQMLLKSLIKDADRVMADLGLNERQVIQKALSDAQSH
VNCLSDLVGQRRKYLNKALSEKTQFLMAVFQATSQIQQHERKIMFREHICLLPDDVSKQV
KTCKSAQASLKTYQNEVTGLWAQGRELMKEVTEQEKSEVLGKLQELQSVYDSVLQKCSHR
LQELEKNLVSRKHFKEDFDKACHWLKQADIVTFPEINLMNESSELHTQLAKYQNILEQSP
EYENLLLTLQRTGQTILPSLNEVDHSYLSEKLNALPRQFNVIVALAKDKFYKVQEAILAR
KEYASLIELTTQSLSELEAQFLRMSKVPTDLAVEEALSLQDGCRAILDEVAGLGEAVDEL
NQKKEGFRSTGQPWQPDKMLHLVTLYHRLKRQTEQRVSLLEDTTSAYQEHEKMCQQLERQ
LKSVKEEQSKVNEETLPAEEKLKMYHSLAGSLQDSGIVLKRVTIHLEDLAPHLDPLAYEK
ARHQIQSWQGELKLLTSAIGETVTECESRMVQSIDFQTEMSRSLDWLRRVKAELSGPVYL
DLNLQDIQEEIRKIQIHQEEVQSSLRIMNALSHKEKEKFTKAKELISADLEHSLAELSEL
DGDIQEALRTRQATLTEIYSQCQRYYQVFQAANDWLEDAQELLQLAGNGLDVESAEENLK
SHMEFFSTEDQFHSNLEELHSLVATLDPLIKPTGKEDLEQKVASLELRSQRMSRDSGAQV
DLLQRCTAQWHDYQKAREEVIELMNDTEKKLSEFSLLKTSSSHEAEEKLSEHKALVSVVN
SFHEKIVALEEKASQLEKTGNDASKATLSRSMTTVWQRWTRLRAVAQDQEKILEDAVDEW
TGFNNKVKKATEMIDQLQDKLPGSSAEKASKAELLTLLEYHDTFVLELEQQQSALGMLRQ
QTLSMLQDGAAPTPGEEPPLMQEITAMQDRCLNMQEKVKTNGKLVKQELKDREMVETQIN
SVKCWVQETKEYLGNPTIEIDAQLEELQILLTEATNHRQNIEKMAEEQKEKYLGLYTILP
SELSLQLAEVALDLKIRDQIQDKIKEVEQSKATSQELSRQIQKLAKDLTTILTKLKAKTD
NVVQAKTDQKVLGEELDGCNSKLMELDAAVQKFLEQNGQLGKPLAKKIGKLTELHQQTIR
QAENRLSKLNQAASHLEEYNEMLELILKWIEKAKVLAHGTIAWNSASQLREQYILHQTLL
EESKEIDSELEAMTEKLQYLTSVYCTEKMSQQVAELGRETEELRQMIKIRLQNLQDAAKD
MKKFEAELKKLQAALEQAQATLTSPEVGRLSLKEQLSHRQHLLSEMESLKPKVQAVQLCQ
SALRIPEDVVASLPLCHAALRLQEEASRLQHTAIQQCNIMQEAVVQYEQYEQEMKHLQQL
IEGAHREIEDKPVATSNIQELQAQISRHEELAQKIKGYQEQIASLNSKCKMLTMKAKHAT
MLLTVTEVEGLAEGTEDLDGELLPTPSAHPSVVMMTAGRCHTLLSPVTEESGEEGTNSEI
SSPPACRSPSPVANTDASVNQDIAYYQALSAERLQTDAAKIHPSTSASQEFYEPGLEPSA
TAKLGDLQRSWETLKNVISEKQRTLYEALERQQKYQDSLQSISTKMEAIELKLSESPEPG
RSPESQMAEHQSFLQALMDEILMLQDEINELQSSLAEELVSESCEADPAEQLALQSTLTV
LAERMSTIRMKASGKRQLLEEKLNDQLEEQRQEQALQRYRCEADELDSWLLSTKATLDTA
LSPPKEPMDMEAQLMDCQNMLVEIEQKVVALSELSVHNENLLLEGKAHTKDEAEQLAGKL
RRLKGSLLELQRALHDKQLNMQQGTAQEKEESDVDLTATQSPGVQEWLAQARTTWTQQRQ
SSLQQQKELEQELAEQKSLLRSVASRGEEILIQHSAAETSGDAGEKPDVLSQELGMEGEK
SSAEDQMRMKWESLHQEFSTKQKLLQNVLEQEQEQVLYSRPNRLLSGVPLYKGDVPTQDK
SAVTSLLDGLNQAFEEVSSQSGGAKRQSIHLEQKLYDGVSATSTWLDDVEERLFVATALL
PEETETCLFNQEILAKDIKEMSEEMDKNKNLFSQAFPENGDNRDVIEDTLGCLLGRLSLL
DSVVNQRCHQMKERLQQILNFQNDLKVLFTSLADNKYIILQKLANVFEQPVAEQIEAIQQ
AEDGLKEFDAGIIELKRRGDKLQVEQPSMQELSKLQDMYDELMMIIGSRRSGLNQNLTLK
SQYERALQDLADLLETGQEKMAGDQKIIVSSKEEIQQLLDKHKEYFQGLESHMILTETLF
RKIISFAVQKETQFHTELMAQASAVLKRAHKRGVELEYILETWSHLDEDQQELSRQLEVV
ESSIPSVGLVEENEDRLIDRITLYQHLKSSLNEYQPKLYQVLDDGKRLLISISCSDLESQ
LNQLGECWLSNTNKMSKELHRLETILKHWTRYQSESADLIHWLQSAKDRLEFWTQQSVTV
PQELEMVRDHLNAFLEFSKEVDAQSSLKSSVLSTGNQLLRLKKVDTATLRSELSRIDSQW
TDLLTNIPAVQEKLHQLQMDKLPSRHAISEVMSWISLMENVIQKDEDNIKNSIGYKAIHE
YLQKYKGFKIDINCKQLTVDFVNQSVLQISSQDVESKRSDKTDFAEQLGAMNKSWQILQG
LVTEKIQLLEGLLESWSEYENNVQCLKTWFETQEKRLKQQHRIGDQASVQNALKDCQDLE
DLIKAKEKEVEKIEQNGLALIQNKKEDVSSIVMSTLRELGQTWANLDHMVGQLKILLKSV
LDQWSSHKVAFDKINSYLMEARYSLSRFRLLTGSLEAVQVQVDNLQNLQDDLEKQERSLQ
KFGSITNQLLKECHPPVTETLTNTLKEVNMRWNNLLEEIAEQLQSSKALLQLWQRYKDYS
KQCASTVQQQEDRTNELLKAATNKDIADDEVATWIQDCNDLLKGLGTVKDSLFFLHELGE
QLKQQVDASAASAIQSDQLSLSQHLCALEQALCKQQTSLQAGVLDYETFAKSLEALEAWI
VEAEEILQGQDPSHSSDLSTIQERMEELKGQMLKFSSMAPDLDRLNELGYRLPLNDKEIK
RMQNLNRHWSLISSQTTERFSKLQSFLLQHQTFLEKCETWMEFLVQTEQKLAVEISGNYQ
HLLEQQRAHELFQAEMFSRQQILHSIIIDGQRLLEQGQVDDRDEFNLKLTLLSNQWQGVI
RRAQQRRGIIDSQIRQWQRYREMAEKLRKWLVEVSYLPMSGLGSVPIPLQQARTLFDEVQ
FKEKVFLRQQGSYILTVEAGKQLLLSADSGAEAALQAELAEIQEKWKSASMRLEEQKKKL
AFLLKDWEKCEKGIADSLEKLRTFKKKLSQSLPDHHEELHAEQMRCKELENAVGSWTDDL
TQLSLLKDTLSAYISADDISILNERVELLQRQWEELCHQLSLRRQQIGERLNEWAVFSEK
NKELCEWLTQMESKVSQNGDILIEEMIEKLKKDYQEEIAIAQENKIQLQQMGERLAKASH
ESKASEIEYKLGKVNDRWQHLLDLIAARVKKLKETLVAVQQLDKNMSSLRTWLAHIESEL
AKPIVYDSCNSEEIQRKLNEQQELQRDIEKHSTGVASVLNLCEVLLHDCDACATDAECDS
IQQATRNLDRRWRNICAMSMERRLKIEETWRLWQKFLDDYSRFEDWLKSSERTAAFPSSS
GVIYTVAKEELKKFEAFQRQVHECLTQLELINKQYRRLARENRTDSACSLKQMVHEGNQR
WDNLQKRVTSILRRLKHFIGQREEFETARDSILVWLTEMDLQLTNIEHFSECDVQAKIKQ
LKAFQQEISLNHNKIEQIIAQGEQLIEKSEPLDAAIIEEELDELRRYCQEVFGRVERYHK
KLIRLPLPDDEHDLSDRELELEDSAALSDLHWHDRSADSLLSPQPSSNLSLSLAQPLRSE
RSGRDTPASVDSIPLEWDHDYDLSRDLESAMSRALPSEDEEGQDDKDFYLRGAVGLSDVM
IPESPEAYVKLTENAIKNTSGDHSALESQIRQLGKALDDSRFQIQQTENIIRSKTPTGPE
LDTSYKGYMKLLGECSSSIDSVKRLEHKLKEEEESLPGFVNLHSTETQTAGVIDRWELLQ
AQALSKELRMKQNLQKWQQFNSDLNSIWAWLGDTEEELEQLQRLELSTDIQTIELQIKKL
KELQKAVDHRKAIILSINLCSPEFTQADSKESRDLQDRLSQMNGRWDRVCSLLEEWRGLL
QDALMQCQIFTGQVGRPFLNIKGFHEMSHGLLLMLENIDRRKNEIVPIDSNLDAEILQDH
HKQLMQIKHELLESQLRVASLQDMSCQLLVNAEGTDCLEAKEKVHVIGNRLKLLLKEVSR
HIKELEKLLDVSSSQQDLSSWSSADELDTSGSVSPTSGRSTPNRQKTPRGKCSLSQPGPS
VSSPHSRSTKGGSDSSLSEPGPGRSGRGFLFRVLRAALPLQLLLLLLIGLACLVPMSEED
YSCALSNNFARSFHPMLRYTNGPPPL
Download sequence
Identical sequences XP_006715470.1.92137 XP_016866097.1.92137 XP_016866098.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]