SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006723848.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006723848.1.92137
Domain Number 1 Region: 223-465
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.05e-50
Family Voltage-gated potassium channels 0.0011
Further Details:      
 
Domain Number 2 Region: 63-177
Classification Level Classification E-value
Superfamily POZ domain 6.28e-28
Family Tetramerization domain of potassium channels 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006723848.1.92137
Sequence length 513
Comment PREDICTED: potassium voltage-gated channel subfamily G member 1 isoform X1 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQDEPRQGCQPED
RRRRIIINVGGIKYSLPWTTLDEFPLTRLGQLKACTNFDDILNVCDDYDVTCNEFFFDRN
PGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIAEDHLDGCCKRRYLQKIEEFAEMV
EREEEDDALDSEGRDSEGPAEGEGRLGRCMRRLRDMVERPHSGLPGKVFACLSVLFVTVT
AVNLSVSTLPSLREEEEQGHCSQMCHNVFIVESVCVGWFSLEFLLRLIQAPSKFAFLRSP
LTLIDLVAILPYYITLLVDGAAAGRRKPGAGNSYLDKVGLVLRVLRALRILYVMRLARHS
LGLQTLGLTARRCTREFGLLLLFLCVAIALFAPLLYVIENEMADSPEFTSIPACYWWAVI
TMTTVGYGDMVPRSTPGQVVALSSILSGILLMAFPVTSIFHTFSRSYLELKQEQERVMFR
RAQFLIKTKSQLSVSQDSDILFGSASSDTRDNN
Download sequence
Identical sequences G1R5R7 G3QEX6 H2P2B0 H2R2Y3 Q9UIX4
ENSPTRP00000044623 ENSNLEP00000008539 gi|27436988|ref|NP_002228.2| ENSP00000360626 ENSPTRP00000044623 ENSNLEP00000008539 ENSNLEP00000023968 ENSPPYP00000012440 ENSGGOP00000000831 NP_002228.2.87134 NP_002228.2.92137 XP_003252984.1.23891 XP_003815317.1.60992 XP_006723848.1.92137 XP_008966451.1.60992 XP_008966452.1.60992 XP_008966453.1.60992 XP_008966457.1.60992 XP_011527102.1.92137 XP_011527103.1.92137 XP_011527104.1.92137 XP_011527105.1.92137 XP_011527106.1.92137 XP_011527107.1.92137 XP_011527108.1.92137 XP_012367187.1.23891 XP_014198579.1.60992 XP_016793626.1.37143 XP_016793627.1.37143 XP_016793628.1.37143 XP_016793630.1.37143 XP_016793631.1.37143 XP_018872245.1.27298 XP_018872246.1.27298 XP_018872247.1.27298 XP_018872250.1.27298 ENSGGOP00000000831 9598.ENSPTRP00000044623 9600.ENSPPYP00000012440 9606.ENSP00000360626 ENSP00000360626 ENSP00000360626 ENSPPYP00000012440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]